SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009969 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009969
Domain Number 1 Region: 35-110
Classification Level Classification E-value
Superfamily EF-hand 0.0000000262
Family Calmodulin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009969   Gene: ENSGMOG00000009295   Transcript: ENSGMOT00000010237
Sequence length 146
Comment pep:novel genescaffold:gadMor1:GeneScaffold_752:86229:87641:-1 gene:ENSGMOG00000009295 transcript:ENSGMOT00000010237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRIQGGKEFGALKSAQEERLNKINEEFLSDTQYEEVEDLSSKLELFKTKFMEFDLDIS
GDLDIMGLKQMLEKLGKAKTHLELKKILSQVSAGETISYRDFLHMMLGKNNSILKLILMF
EDMGKDKEPAETGPPGRRTFANAGLP
Download sequence
Identical sequences ENSGMOP00000009969 ENSGMOP00000009969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]