SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010003 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010003
Domain Number 1 Region: 96-246
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.07e-26
Family Voltage-gated potassium channels 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010003   Gene: ENSGMOG00000009369   Transcript: ENSGMOT00000010272
Sequence length 249
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1708:80:14843:-1 gene:ENSGMOG00000009369 transcript:ENSGMOT00000010272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESEYEMREKEQLEAEEKRLQGKYNISDEDYR
QLETIIMEAEPHRAGVQWKFAGSFXXXXXXXXXXXYGHAAPGTDAGKAFCMFYAVLGIPL
TLVMFQSLGERMNTFVKYLLKRIKKCCGMSVTDVSMENMVTVGFFSCIGTLCVGAAAFSH
YEDWSFFQSYYYCFITLTTIGFGDFVALQKNRALQKKPLYVAFSFMYILVGLTVIGAFLN
LVVLRFLTM
Download sequence
Identical sequences ENSGMOP00000010003 ENSGMOP00000010003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]