SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010104 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010104
Domain Number 1 Region: 156-218
Classification Level Classification E-value
Superfamily EF-hand 0.0000000466
Family Polcalcin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010104   Gene: ENSGMOG00000009459   Transcript: ENSGMOT00000010377
Sequence length 311
Comment pep:novel genescaffold:gadMor1:GeneScaffold_355:86589:91015:-1 gene:ENSGMOG00000009459 transcript:ENSGMOT00000010377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGGPASCRSTMGGRSYFVFVLVFFHMCIMNGIAQLYENHNNGGEEEATRGLDPRSRLSDP
EAGSRTPKPETVREFFLPRIDGVKVGHVQKLSIVPDKVHEMRTLSLKPLLFEIPGFLSDA
ECGVVMQLAQLKGLVESQLMVQEGQEELAEELDLSPDEIFSLLDISQDGQLQLSEILTHS
RVREGIWLTPESLREIYAGIHADKDHNGLLSLEEFRQLSSDAFQRFLLQRGVESSQLVRN
SHHTWLEQGPGAHPVLQSVKQRVVRLTQLPDPLVDLSEPLQVVRYQQGGHYHAHHDSGPV
YPETACTHTRP
Download sequence
Identical sequences ENSGMOP00000010104 ENSGMOP00000010104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]