SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010216 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010216
Domain Number 1 Region: 943-1110,1172-1233,1303-1402
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 6.63e-111
Family Mammalian PLC 0.0000045
Further Details:      
 
Domain Number 2 Region: 1672-1780
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-37
Family Ras-binding domain, RBD 0.00000836
Further Details:      
 
Domain Number 3 Region: 86-282,311-335
Classification Level Classification E-value
Superfamily Ras GEF 3.53e-33
Family Ras GEF 0.0061
Further Details:      
 
Domain Number 4 Region: 1427-1538
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.38e-21
Family PLC-like (P variant) 0.0023
Further Details:      
 
Domain Number 5 Region: 1567-1668
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-17
Family Ras-binding domain, RBD 0.00029
Further Details:      
 
Domain Number 6 Region: 757-789,867-931
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000456
Family EF-hand modules in multidomain proteins 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000010216
Domain Number - Region: 419-545
Classification Level Classification E-value
Superfamily PH domain-like 0.000184
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010216   Gene: ENSGMOG00000009528   Transcript: ENSGMOT00000010494
Sequence length 1797
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1378:23664:86575:1 gene:ENSGMOG00000009528 transcript:ENSGMOT00000010494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WYRAVGQHTALSSLLGGALLEATSALCSRSSQLLLFLIQPHGPSTHIMLKERQVSGSTTG
GSGGVRRPRGSGVSRELSDLRSLAQFPEEIACILTQQEQELYQRVFPLDYLCFLTRDLGG
TEGQTKRHPSLKASLGPALPTHNAQRRNAVEDLVARFNEVSSWVTWLVLTASSMEEKREV
FSYLVHTARCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMEQADIETMRGLKDAMAQHESS
AEYKKLLTRALNIPGCKVVPFCGVFLKELSDALDGTASIISLKAPLENTDSDSLEFVSDY
HGQQHFMSRSGPDGLHVPEKEATVSNILQIIRSCNRSLEADDSDETTSPLPRCPAPNNNS
FRERSYNPFTVGDVSDAEAEPCLEAGGKEVEFQGTEETHPAFAHNTEIIPWYVLSLQPDT
HQFLLQGATVIHYDQDSHLSARCLLTLQPDNTTLTWGKGTPPPPPATEPPVGLGQTVFAG
LAEGLLDLGVVKAVFLGHHGADVHAVCLQNKLSQMTAEDNALTLLYGLGTTDNRLLHFVA
PNHTAQALHKGLSELVNATRKLKRFPDQRLQWLRRQYVSLYQEDGRYEGPSLAQAIELFG
GRRWNMGAGGAEKAGGQKNNTLGNEKTKKKKKVLVRGDSGDVTDDEMVSRKTRSCKEALG
RNGMEFNDSMDQDESEDSFPGPFSLSANRSPAMLASSSSSSTSSSSSSSMVGAVQTRPQA
SPVLSGAAKTPPPGAWSSRSWHGRCKGCFKGFQNLMISDSSMSFIEFVELFKSFSIRSRK
DLKELFDTFAVPVSRSSPESAPLYTNLRIDDLDMGLQPDLDLLTRNGSDLGLFIRTQQQM
TDNQKQISDAIAAASIVSNGTGVENASLGVLGMAIPQLNDFLVNCQREHLSYDDILSIIQ
KFEPSSSMRQMGWMSFEGFARYLMDKENCASRHEESQVDPAELQHPLSYYYIESSHNTYL
TGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAVNR
SAFVNSDMPVILSIENHCSLPQQRKMADIFKAVFGERLVMRFLLESDFSDDLLPSPLQLR
GKILLKNKKLKAHQAPVDILKQKAHQLAHMQAQASNGGSPGVGSTGNNTNEEEEEEEDEY
DYDYESLSDDNILDDKPEGKSTAEKEEPPTDEVPKRSSKKPERAANCKGKVFDMELGEEF
YLPQNKKESRQIAQELSDLIIYCQAIKFPGLSTLSPTDSGRGKDRGKGRKSIFGAAPARI
NTLGDSAPQTRPSGKGGAECVRLSWEEHQTSPVPSAPASLSSIIRTPKCYHISSVNENAA
KRLCRRYSRKLIQHTGSQLLRTYPAATRIDSANPSPLPFWLHGIQLVALNYQTDDLPLQL
NEALFEANGGCGYVLKPAVLWDRCCPLYQQFCPLERDVENMTPITYTLTVISGQNVCPGN
SAGSPCVEVDVLGMPVDASHFRSKPIHRNTLNPMWGESFQFTVHFEELCFLRIAVVENNS
SQTTAQRTLPIKALKPGYRHLQLRTQHNESLEVSGLFIYSRRNEDGPAGGAVPSSMWYST
DDQRTYQKHRLTVHGAPGPEPFTVFPVCPQTTARQLLDMVVSPTGSPSDYFLCEERLPLA
KERSEARQRPLAPEEEVLRLVSGWHTEEGLVGRISLRAREENCNERSTLGEEEMFFVQVH
DVSPEQPHTVIKAPRSSTSQDIIQQTLSKAKYSVSILSNPNPTDYVLMEEVTKDPGSKKA
STAKPIQRILLDHECVYQAQSRWRGVGKFILKLKEQVMPREDKRKGISFASELKKLT
Download sequence
Identical sequences ENSGMOP00000010216 ENSGMOP00000010216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]