SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010241 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010241
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.88e-30
Family G proteins 0.00000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010241   Gene: ENSGMOG00000009588   Transcript: ENSGMOT00000010520
Sequence length 193
Comment pep:novel genescaffold:gadMor1:GeneScaffold_748:287:4331:1 gene:ENSGMOG00000009588 transcript:ENSGMOT00000010520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TYVPTVFENYTASLQLEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDTSRPDSV
DGTLKKWKAEILDFCPSTRILLIGCKTDLRSDVCTLTELSHGKHIPVSHEQGASLARQLG
AEAYLECSAFTSEKSVHSAFRSAALACMNRLPPAPRASPVSRLSKRLLRLSNSTGLLASA
FKTKDKAKGCAIM
Download sequence
Identical sequences ENSGMOP00000010241 ENSGMOP00000010241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]