SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010284 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010284
Domain Number 1 Region: 1-216
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.69e-76
Family Calponin-homology domain, CH-domain 0.0000205
Further Details:      
 
Domain Number 2 Region: 234-356
Classification Level Classification E-value
Superfamily Spectrin repeat 8.2e-33
Family Spectrin repeat 0.00000061
Further Details:      
 
Domain Number 3 Region: 470-591
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-31
Family Spectrin repeat 0.00000298
Further Details:      
 
Domain Number 4 Region: 357-465
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-25
Family Spectrin repeat 0.00000237
Further Details:      
 
Domain Number 5 Region: 700-848
Classification Level Classification E-value
Superfamily EF-hand 8.81e-24
Family Calmodulin-like 0.021
Further Details:      
 
Domain Number 6 Region: 595-706
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-20
Family Spectrin repeat 0.00000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010284   Gene: ENSGMOG00000009617   Transcript: ENSGMOT00000010565
Sequence length 854
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3995:1419:20294:-1 gene:ENSGMOG00000009617 transcript:ENSGMOT00000010565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVN
KALDYICSKGVKLVSIGAEAEIVDGNAKMTLGMIWTIXXXXXXXXXXXXXTSAKEGLLLW
CQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAE
KFLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENE
KLMEEYEKLASELLEWIRRTIPWLENRAAEQTMRAMQQKLEDFRDYRRVHKPPRVQEKCQ
LEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLD
HLAEKFKQKCSLHETWTGGKEELLSQKDFESASLMEIRALMRKHEAFESDLAAHQDRVEQ
IAAIAQELNELDYHDAVTVNARCQGICDQWDNLGTLTQKRRDSLERVEKLWETIDQLYLE
FAKRAAPFNNWMDGAMEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMATMGIQS
EILKIAQTYGIKLSGINPYTNLSPQDISNKWDAVKHLVPLRDQMLQEEVARQQANERLRR
QFAAQANIIGPWIQTKMEEIGHVSADITGSLEDQMNNLKQYEQNIINYKSNIDKLEGDHQ
LSQESLIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRA
SFNHFDRKRNGMMDPDDFRACLISMGYDLGEVEFARIMTLVDANNTGVVTFQAFIDFMTR
ETAETDTAEQVMASFKILASDKSYITVDELRRELPLEQAEYCISRMTRYVGADGTTGALD
YISFSSALYGESDL
Download sequence
Identical sequences ENSGMOP00000010284 ENSGMOP00000010284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]