SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010288 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010288
Domain Number 1 Region: 13-66
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000852
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0047
Further Details:      
 
Domain Number 2 Region: 172-247
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000137
Family Ras-binding domain, RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010288   Gene: ENSGMOG00000009628   Transcript: ENSGMOT00000010569
Sequence length 302
Comment pep:novel genescaffold:gadMor1:GeneScaffold_355:247368:250801:-1 gene:ENSGMOG00000009628 transcript:ENSGMOT00000010569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEGPLFHPRDTGKGHDFLPCSYTHLTWCDLCGEFVWGLYKQSLCCANCRYICHDRCRPFI
QLDCSAGGHLAPEPADLSVDTIETDTNVDEQIEWGKQELTFGEIQQKIKEYNAQINNNHF
MVNNKDGSYTGFIRVQFQLARPISLPLPRKLSLTQDKPTTRRTSFYLPRDSAKHLHISSQ
TRAREVIQALLNKFTVVDNPGKFALFERTECQNQVYLRKVSDDACPLHLRLCAGPGEKAL
SLVLKENDTGDINWDAFSFPELCNFLRMLQREEEVHIRQIVKRYALAREEIKQAMSGVSI
LC
Download sequence
Identical sequences ENSGMOP00000010288 ENSGMOP00000010288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]