SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010298 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000010298
Domain Number - Region: 40-93
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0267
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010298   Gene: ENSGMOG00000009636   Transcript: ENSGMOT00000010580
Sequence length 190
Comment pep:novel genescaffold:gadMor1:GeneScaffold_110:6132:23307:1 gene:ENSGMOG00000009636 transcript:ENSGMOT00000010580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLPDELTLKHMAQDYSSLKNQLLKLQTILQCEDADTLQAAVEEGEVNTTASQLEDLMQEV
QVLREELSGRDKTIAQLTLRCHQLQQQQHLQQQQPAQGLPGRCHCQHQRTPSNLRQMDRR
LKDKATQTHLRTHSQAGALATPLLSLWQAQHQGSARTSMPQRRQISSTSAFQPLPQPSPP
PGKSSKTSNR
Download sequence
Identical sequences ENSGMOP00000010298 ENSGMOP00000010298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]