SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010325 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010325
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000133
Family I set domains 0.029
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000010325
Domain Number - Region: 90-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00315
Family C1 set domains (antibody constant domain-like) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010325   Gene: ENSGMOG00000009665   Transcript: ENSGMOT00000010607
Sequence length 158
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1904:3473:4126:1 gene:ENSGMOG00000009665 transcript:ENSGMOT00000010607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPVLVGTTLDAQCRVRGTPMLTEVYLYKDDVLVSSRTDGMADFTLPNVNLTYQGTYHCLA
GWFDGQQNLAKSLGNPVTVEEVVSKPILAGGERQPAKDMTLNCHLHQTDPAAEVHVYFYR
DGTKLEGIARSQKRARLCPGEYSCGARVPSLKLYKWSE
Download sequence
Identical sequences ENSGMOP00000010325 ENSGMOP00000010325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]