SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010331 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010331
Domain Number 1 Region: 32-159
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.58e-56
Family N-terminal domain of cbl (N-cbl) 0.000000368
Further Details:      
 
Domain Number 2 Region: 246-332
Classification Level Classification E-value
Superfamily SH2 domain 1.44e-46
Family SH2 domain 0.00000326
Further Details:      
 
Domain Number 3 Region: 338-416
Classification Level Classification E-value
Superfamily RING/U-box 4.65e-42
Family RING finger domain, C3HC4 0.00000964
Further Details:      
 
Domain Number 4 Region: 161-245
Classification Level Classification E-value
Superfamily EF-hand 5.9e-36
Family EF-hand modules in multidomain proteins 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010331   Gene: ENSGMOG00000009654   Transcript: ENSGMOT00000010613
Sequence length 846
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4350:52839:76822:-1 gene:ENSGMOG00000009654 transcript:ENSGMOT00000010613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGNPRRGAGLIGLMKDAFQPHQQPLQPHQPPVVDKKMVEKCWKLMDKVVRLCQNPKVALK
NSPPYILDLLPDTYQHLRTILSRYEGKMEVLGENEYFRVVIENLTNKIKQTISLFKEAKE
RMYEENSQPRRNLTKLSLIFSHMLAELKAIFPNGLFQGDNFRITKADAADFWRRSFGDKT
IVPWRTFRQALHEFHPISSGLEAMALKSTIDLTFNDYISVFEFDIFTRLFQPWASLLRNW
NSLAVTHSGYMAFLTYDEVKARLHRFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTI
PHNKPLFQALIDGYREGFYLFPDGRAQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGSTF
QLCKICAENDKDVKIEPCSHLMCTSCLTAWQESEGQGCPFCRCEIKGTEPIVVDPFRPKP
NGASFAGFQGPCRAEGNEEDEDDRLEDQHLVMSRLACSKVERPSSPVSPLPPVPPRLDLL
QQRPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAAVSEDMVSPEGEENEYMSPTSLPASG
AAWVIPGALVPPPPSAQASRHNDLDLDDPQVYESMCNIQDQVAEAAAPALDSERPRHSPV
APQDKPAEAEGVYEYDYPRPMAPPAPARRTLSDISGSSPAFSSLSLDRSXXXVAAVGPGR
PPQPLPRRANSDRWRPNPEVPPGHGSSGEIEGDVPGLLSRTSRRLMIAQNNLETAKNILR
EFVSVR
Download sequence
Identical sequences ENSGMOP00000010331 ENSGMOP00000010331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]