SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010336 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010336
Domain Number 1 Region: 167-284
Classification Level Classification E-value
Superfamily EF-hand 9.67e-32
Family Osteonectin 0.031
Further Details:      
 
Domain Number 2 Region: 254-350
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.4e-27
Family Thyroglobulin type-1 domain 0.00069
Further Details:      
 
Domain Number 3 Region: 103-147
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000222
Family Ovomucoid domain III-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010336   Gene: ENSGMOG00000009673   Transcript: ENSGMOT00000010618
Sequence length 408
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3589:552:237201:1 gene:ENSGMOG00000009673 transcript:ENSGMOT00000010618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDYFKSWPPAKSLDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXAYAARDPCRKVRCPPHK
VCVSQDAVTAVCTRRKQPAPGVKARKGSVGNKHWLEAGAHGKCRPCSGSRSSSVCGSDGH
TYSSKCKLDFHGCLSGKVLSVKCDGLCPCLPSQVASRPARPTTKDGSDRDLHSLASRLKD
WFGVLHLDANRDLKASDSSDSAQGRFDTSILPICKDSLGWMFNKLDLNFDLLLDQSELST
LYLDKYELCMKPLFNSCDSFKDGKLSNNEWCYCFQKPEGLPCQNQRSRVQLLGRQKSLIG
AYIPRCTEVGYFKPTQCHGSTGQCWCVDKYGNEIAGSRKQGHPSCDEDQETSGDFSSGGG
VVLLEDQEEEPSLSGRGRQKKRRGRIHPRGTMEDDEDREEDDEMGYVW
Download sequence
Identical sequences ENSGMOP00000010336 ENSGMOP00000010336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]