SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010340 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010340
Domain Number 1 Region: 73-636
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2e-176
Family Myeloperoxidase-like 0.000000000559
Further Details:      
 
Domain Number 2 Region: 642-696
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000834
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010340   Gene: ENSGMOG00000009674   Transcript: ENSGMOT00000010622
Sequence length 696
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1240:166616:181865:1 gene:ENSGMOG00000009674 transcript:ENSGMOT00000010622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQVEPGSLMVSQAAEVFENNLQILKDEAKWRNKRDMVASEHILLEDLEFMADLSGCPSPA
HAAICLWQSPLDNYRTISGLCNNRHNPTWGAANTALVRWLPAQYEDGEKQPKGWNHGRLH
NGFTLPLVEAVSKKIMKSSFKRKENLYSQLMIEWGQFIDHDITFTPQSTRDATDIGVDCL
DTCQNIHPCFPIQAKGCMPFFRSSPACIDNSANNFPLQRQQINTITSFIDASVVYGHTLE
LQSLIRNYTSPTGRLAINKIFKDGEGRPYLPSVEASPSACFQNPHLKRVECFAAGDSRVN
EGLSLIALHTLWLREHNRLAGALKVLNSHWSKETVYQETRKIIGALHQIITMRDYIPKII
GQESFDRYIGPYMGYDPTVNPSASNVFATAAFRFGHATISTVVRRFNESFQTHEQFTHLR
LHHTFFSPWRIVKEGGIEPVLRGLMGTAATSVSTDKLIAEEMTEKLVVLNIQWKLDLAAL
NLQRGRDHALAGFNDWREFCGLKRLKIKEDFQDVVKDKIIVNKILKMYKNPDNIDVWLGG
LVEDHLKDSRNGPLFSCLIAKQMKSIRDGDKFWWEAQGTFTKHQISELSKSSLSRIICDN
SKVTEIPLDAFKYGKYPNGFLPCNHIPNINLEAWREKKKTDICDSPADIKNGDFLLFSSS
GKLVAHYICYHGFRLKGTDKLECNESGWSDPPPECT
Download sequence
Identical sequences ENSGMOP00000010340 ENSGMOP00000010340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]