SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010378 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010378
Domain Number 1 Region: 3-101
Classification Level Classification E-value
Superfamily EF-hand 8.3e-20
Family Parvalbumin 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010378   Gene: ENSGMOG00000009712   Transcript: ENSGMOT00000010660
Sequence length 101
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4150:24357:25344:1 gene:ENSGMOG00000009712 transcript:ENSGMOT00000010660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMTDLLKAEDIKKALDAFAVADSFDHRKFFELVGMRAMEADSVNKVFQALDVDASGYIE
EEELKFVLKGFSEEGRDLTDAETKKFLDAADKDGDGKIGMD
Download sequence
Identical sequences ENSGMOP00000010378 ENSGMOP00000010378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]