SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010405 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010405
Domain Number 1 Region: 571-704
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-38
Family Phosphotyrosine-binding domain (PTB) 0.00000296
Further Details:      
 
Domain Number 2 Region: 409-550
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-29
Family Phosphotyrosine-binding domain (PTB) 0.0083
Further Details:      
 
Domain Number 3 Region: 276-313
Classification Level Classification E-value
Superfamily WW domain 0.0000000404
Family WW domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010405   Gene: ENSGMOG00000009728   Transcript: ENSGMOT00000010687
Sequence length 760
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3589:276642:317319:1 gene:ENSGMOG00000009728 transcript:ENSGMOT00000010687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSVQTPPLSRSGSSPSNVGSSHRGGGTSSAPPTSLSLRSSYNHLLGREIIRESAAGAETF
SSATLPKSRQRYAGTTVRGAMGLGDNLLSNPFNNANPKLAKNGANMQRRAESQQMELCKA
GVRNDADNNNADKDNSQLPPFRRRTRSFLEYHGKGLDLDLSWGRKEEENQEQQQQQQQQQ
QQPSPVKVELHPNNENQFLQQYPPSSPKTTRAAERISTPSRGRQPPPGPGGPRAGLPKVG
FRMDLPPDTPSEDEDSSWTTLSQETPSPQTPNETAEVWTEGELPPGWREVSAPSEVYFWH
VPTGTTQYHRPVAADNQGTSPTPGGPDPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXYPDPSLKAFEGATLRYASLSLNPAAQLETVDLNSACTDAEAMSFPVRSLG
WVEMAERDLCEGRSSIAVHHCIRQLSYCRRDIRDSAGVWGEGKGMLLELQDRMLTLVDPE
DRSLLHSQPISSIRVWGVGRDHDXXXXXDFAYVARDKNTRVLKCHVFRCDTPAAAIATSL
HEVCSKIMAERKSAKAAVSSSSQNGSDVPLQAEFPMPKTELVQKFHVLYLGMTSVSRPIG
MDVINSAIENLLASTGKEDWTPVILSVADADVAVIKEKEEEEEVLVECRVRFLSFMGVGR
DVHTFAFIMDSGNQHFQCHIFWCEPNAGCVSEAVQAACVLRYQKCLVARPPSQRAASCSS
STSSSTSPDSVTRRVTTSVKRGVQSLIDNLKTKKQPSELP
Download sequence
Identical sequences ENSGMOP00000010405 ENSGMOP00000010405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]