SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010503 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010503
Domain Number 1 Region: 184-363
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-25
Family DBL homology domain (DH-domain) 0.0021
Further Details:      
 
Domain Number 2 Region: 721-945
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000467
Family WD40-repeat 0.019
Further Details:      
 
Domain Number 3 Region: 375-454
Classification Level Classification E-value
Superfamily PH domain-like 0.0000753
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010503   Gene: ENSGMOG00000009798   Transcript: ENSGMOT00000010790
Sequence length 976
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1012:11334:267275:1 gene:ENSGMOG00000009798 transcript:ENSGMOT00000010790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCVCVCDLRRSERWPVSADNGWSSSEFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSPE
VRGLRERCARTKRELASRLGANYDTKVQQFMKAAKSGTKDGLEKTRMAVMRKVSFLQKKD
HAEDPEDDAGYLEVAVSEVKHPPPVLSPMPDGLXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXEYHRPLLEAEPRVLSPRKIRPIFYRLREITQCHSMFQIALASRVAEWDSSEKIGDLF
VASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKQASSVDRITLYGLMVK
PIQRFPQFILLLQDMLKNTPRGHVDRLPLQLALTELETLAEKLNEQKRQADQVAETQQLA
RSVGDRLLSXQLNPEQGSLVLCETLIETVYGDRGQVLKSKERKVFLFEDVLVCANINVTR
GPPDLSSLVPVGPKYTMKWSAPLLLVQVVEVGQEGAQGKDTPYQPSGTKRPGSXXXXXKA
ILGPPRLYQELQELQHDLSLVEEVTLLVGTLQGTYQNLNTTVAQDWCLALHRLIRIKEDQ
IQSANKCRLRLQVPGRPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEAALHNPVHCSLLGFSAASTSLPQGY
LWVASGGEGAQGQLEIFSLNRPTPRAVKSLPLAAGPCLEYVPEPVPPEETEAGPPGAPGA
GNTICVGLDDGSILVYGSVDTAAQCLLTLPHPGGGAVLCIKHASHFLFAGLRSGSVLVYG
RSEGGDLWNPESRRSVGLGSEPVRALLVLEELVWASSGNSVMVIDGSSLSTQXRFEVHPD
PLVSVAHMVRAGGGVWMAFSEGSSIRLFHTETLEHLQEINISTRSTLLSXXQQSLRVSSL
LLCQGLLWVGTAQGSIITLPVPKLEGIPKITGKGMVSLNAHCGPVDFLLASSSSLAPQLL
KRDSLPEGPDSAFGGD
Download sequence
Identical sequences ENSGMOP00000010503 ENSGMOP00000010503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]