SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010519 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010519
Domain Number 1 Region: 55-506
Classification Level Classification E-value
Superfamily Sema domain 4.84e-126
Family Sema domain 0.000000814
Further Details:      
 
Domain Number 2 Region: 502-550
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000227
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010519   Gene: ENSGMOG00000009827   Transcript: ENSGMOT00000010807
Sequence length 897
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2441:104068:157567:1 gene:ENSGMOG00000009827 transcript:ENSGMOT00000010807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALTFALAVSPRLTCGATPFPQDLEPISIVGRESSYLYPSFQGLMSDNDTVRLGLDFQRM
LRINHMLYIAARDHVFAINLPASSERIVPMQKLTWKTKDVEKCTVRGKNSDECYNYIKVL
VPRNDETLFACGTNAFNPACRNYKMATLEQDGEEMLGQARCPFESRQSNVGLFAGRLGDS
TLTGPSTSLLMFLIVCIXXPPSSSPEPHFLHAIEYGNYVYFFFSEIAVEYTTLGKVVFSR
VARVCKNDNGGSPRVLERYWTSFLKARLNCSVPGDSFFYFDVLQSLTNVLQINHRPAVLG
VFTTQANSITGSAVCAFYMDDIEKAFNGKFKEQRNSESAWSPVPEEQVPKPSRRPGCCAA
DGSASTYKSSTTFPDETLTFIKSYPLMDEAVPSVNDQPYFTRTTSRFKLTQITVDTSAGP
YKNHTVVFLGSENGRLLKILASTQGSNASFSTALLEDIDVYNPERCNVHGEDRRVLGLEL
DRDNHAMFVAFSSCVIRVPLSRCSEYSTCKTSCLSSRDPYCVWLRSDSCATVSPGIKGGF
EQDVENSQPQYPENCHXXXXXXXXXXXXXXXXRVGVRRPPDVDKSNHSVHYTLLIACVLV
AFVLGAFLSGFLVSCYCNHTGHKTKRLAKDPEAPIPHALSLRSLAKLNGLLDGQNKDDKL
EVSSPKIYNSFFSNTELSGLPTPESTPELPIKSMKAFKNQWERNQNCNNAKEPKSHNMSS
RPSSALLHQASYPYSHGLSNGQALMCGPLHPEDRKIPNVDRILSQHPYPCYPQKDIHSHH
QSTLERRHSSQRHSLLAAAAKMSIPRQHSFGQRNGGPHQPPPLLARMNSTGSACEVHYPV
IPNGYLARQLSYSGEQQEVMHRGAIVRRTTSLKPDVPPKPLFIPATSPVNQQGKFNY
Download sequence
Identical sequences ENSGMOP00000010519 ENSGMOP00000010519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]