SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010573 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010573
Domain Number 1 Region: 6-460
Classification Level Classification E-value
Superfamily Sema domain 6.93e-150
Family Sema domain 0.00000000685
Further Details:      
 
Domain Number 2 Region: 463-506
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000235
Family Plexin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000010573
Domain Number - Region: 513-555
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00461
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010573   Gene: ENSGMOG00000009878   Transcript: ENSGMOT00000010860
Sequence length 810
Comment pep:novel genescaffold:gadMor1:GeneScaffold_833:8249:32530:1 gene:ENSGMOG00000009878 transcript:ENSGMOT00000010860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLGRQRFTGSVQNYSTLLLDEGAGLLYVGGRGAIYALDTANISAPANATIDWEASAEQKK
QCLNKGKDNQTECYNHIRFLEHYNSTHLYVCGTHAFRPLCAYIDTEHFNFSSGLEEGRDR
CPYDPAKGFTGLLIEGEMFTASQYEFRSSPDVRRNFPLPALRTEEAPTRWLLASEADFVG
SALLKEHVNSSIGDDDKIYFFFTERSQELTAYPSQTRVARVARVCKSDWGGQRTLQKRWT
SFLKARMVCSVPDYELHLNIMRSVFVLQEADAHSSVFYGVFGLEWKNIKASAICQYSFAD
VQSAFDGPYMEVLDSKWREYTGKVPEPRPGSCITDVHRSQGINSSRDLPDSVLTFARRHP
LVAGQVHPVGARPLMFKRNVNYVKIAVHKVTALDGDVYPVFFLGTDHGWLHRAVDIAGEM
HIIEELQLFDKPQPIESLVLSPIMRSVFVGSYSAVVHVPMATCRRYTSCYDCVFARDPFC
AWDRKSCVEIRPHGQRSNLTQDIIRGTRGCRHPSLSFWPVAQRGRSVMAGDDVLLQCELH
SNLATPRWTLNGRELQGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXEFANGLSGTLPSVLRKMNGNSYVLLRQVDQEGTSP
LYHSFTEELNRILEQRKHTQLDVLPDESSI
Download sequence
Identical sequences ENSGMOP00000010573 ENSGMOP00000010573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]