SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010670 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010670
Domain Number 1 Region: 73-165
Classification Level Classification E-value
Superfamily PDZ domain-like 8.39e-20
Family PDZ domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000010670
Domain Number - Region: 263-315
Classification Level Classification E-value
Superfamily EF-hand 0.0128
Family Calmodulin-like 0.038
Further Details:      
 
Domain Number - Region: 348-440
Classification Level Classification E-value
Superfamily Tropomyosin 0.0458
Family Tropomyosin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010670   Gene: ENSGMOG00000009972   Transcript: ENSGMOT00000010965
Sequence length 441
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1050:47372:58906:-1 gene:ENSGMOG00000009972 transcript:ENSGMOT00000010965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLIARDEEAKREFAELLEKYGSNSSTGSTRNSPIQVQAEGTRPLESTSSGSSSRSQSP
LLLSPAGSQNAYASSGALMRSLSHPGEGVIQLITLAHASSLGITLGGGSNRPDGPAVFIQ
EVLSGGDCHRDGRLRPGDQLIAINKESLIGVTHEEARSMLKKVKLSQDSVVEIAFIPGKG
SFPSSSSLHNGAQRAAGSSSGSARYRPPHRSPESHPEETATVSSSSPDIFPPDINISGSA
SAASQSSTPGPKPKITLDPHIRLQFDKLDLALFFLGLEVTEDKRRQLRQSLTTDTQGTVS
YGDFVEATREIFQDHLEEAGLAQGPFMFSYHEAASLMDTSAFHSPTYESECSYSSEDMEQ
FQMELKQGMLKDTEDSKKSLEEELQKTAQKASLTVEENARLRDRLQAAADGAAPPSSAEQ
DYEEVIGLLEAEIRDLKNQLT
Download sequence
Identical sequences ENSGMOP00000010670 ENSGMOP00000010670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]