SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010673 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010673
Domain Number 1 Region: 124-504
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.4e-131
Family Myotubularin-like phosphatases 0.0000000525
Further Details:      
 
Domain Number 2 Region: 11-112
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000486
Family TFIIH domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010673   Gene: ENSGMOG00000009976   Transcript: ENSGMOT00000010968
Sequence length 552
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3821:12736:22390:1 gene:ENSGMOG00000009976 transcript:ENSGMOT00000010968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRTPKVEQVRLLQRRAGQRKPLLGTLYLSATHTIFVENHPETRRETWVLHSMVSGLE
RPPGGPTGSQLVLRCKDFRVFHLLFPLERDCVEVHASLTRLSRPESYSELYCLSINPNTN
QEEREKSWSLVLPSQDYQRMGLPNNLWVATAANSEYKMCDSYPAQLFVSRWASPAVLMGS
SRFRSRGRLPVLSYFHQDTLAAVCRCSQPLSGFSGRSEEDEQMVTAVMKANPGSDFIYVV
DTRPXLNAMANRAAGKGYESEDHYGNIKLHFSGIDNIHVMRSSQQRILDVGEQRTPSMSD
FLLGLENSGWLKHIKAVLDAGVFIAKAIADEGVSVLVHCSDGWDRTAQACSVASVLLEPY
YRTMKGLMVLIEKDWVSFGHKFSHRYGHLDGDPREVSPVLDQFLEVLWQLAQQFPCAFQF
NERFLLDLRTLAYSCQDGTFLGNSEKERRSLRLQERSFSVWSRLWRDREKYWNPLYRAEQ
SQTQGVLRPNTTPYCFKMWKGLYSPAETPAPPAQTPVDFLSSVREGSQQLEQQLANQQEV
AAGGPAPLGSRQ
Download sequence
Identical sequences ENSGMOP00000010673 ENSGMOP00000010673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]