SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010730 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010730
Domain Number 1 Region: 119-503
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.84e-128
Family Myotubularin-like phosphatases 0.000000109
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily PH domain-like 2.7e-18
Family GRAM domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010730   Gene: ENSGMOG00000010038   Transcript: ENSGMOT00000011028
Sequence length 549
Comment pep:novel genescaffold:gadMor1:GeneScaffold_329:191144:204775:-1 gene:ENSGMOG00000010038 transcript:ENSGMOT00000011028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFAELIKTPRVDGVVLHRPFMPTVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDSIEK
RFLGSLGTIIVKCKDLRMIQLDIPGMEECLNIGSSIEALSTLDSVSLMYPYFYRPMFEVI
EDGWNSFLPEDAFKDLEAMTDEWRLSEVNRDFRVCTTYPPLVAVPRDVDDDTLRKAAGFR
HGGRFPVLSYYHKKNGMVMMRSGQPLTGTNGRRCKEDERLINATLRPGKRGYVIDTRTIS
VAQQAKARGGGFETEANYPQWRRIHKAIERSNVLQDSLVKLVEACNDQSHSMDRWLSKLE
ASNWQTHVKEILTTACLAAQCIDREGASVLVHGTEGTDSTLQVTSLAQIILDPACRTIQG
FQGLVEREWLQAGHPFAQRCSMSAYSNSKPRHEAPGFLLFLDCVWQVLRQFPCSFQFTEQ
LLVLLFEHAYASQFGTFLGNSAAERVRLSLPEKTVSLWSWVNRPQEIDHLSNPLYEPNSL
VIWPSVAPQSLLLWEGVFLRWNRSPRCQEEAHEEMVHIIEYNKELQNKVNSLRRQLAQLE
TQEPPLQTP
Download sequence
Identical sequences ENSGMOP00000010730 ENSGMOP00000010730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]