SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010771 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010771
Domain Number 1 Region: 19-454
Classification Level Classification E-value
Superfamily Sema domain 1.11e-110
Family Sema domain 0.0000777
Further Details:      
 
Domain Number 2 Region: 1574-1779
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-32
Family p120GAP domain-like 0.02
Further Details:      
 
Domain Number 3 Region: 804-902
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000152
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 4 Region: 898-981
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000586
Family Other IPT/TIG domains 0.041
Further Details:      
 
Domain Number 5 Region: 457-509
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000331
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 981-1079
Classification Level Classification E-value
Superfamily E set domains 0.000000000049
Family E-set domains of sugar-utilizing enzymes 0.048
Further Details:      
 
Domain Number 7 Region: 1088-1165
Classification Level Classification E-value
Superfamily E set domains 0.0000665
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.059
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000010771
Domain Number - Region: 756-790
Classification Level Classification E-value
Superfamily Plexin repeat 0.000105
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number - Region: 1265-1345
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00018
Family p120GAP domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010771   Gene: ENSGMOG00000010058   Transcript: ENSGMOT00000011069
Sequence length 1809
Comment pep:novel genescaffold:gadMor1:GeneScaffold_104:6589:44870:1 gene:ENSGMOG00000010058 transcript:ENSGMOT00000011069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THLTVHQRSGDVFVRRQQDPPNLTELRSHTTGPVEDNAKCTPPSVRSCAHRLESMDNVNK
LLLVDYSGNRLVACGSIWQGVCQFLRLEDLFKLGEPHHRKEHYLSGAREADGMAGVVIEN
GKGSSHLFIGAAIDGKSEYFPTLSSRKLVEDEESVNMFSLVYQDEFVSSQIKIPSDTLSL
YPAFDIYYVYGFSSRSHVYFLTLQLDIQLTQMDAAGEKFFTSKIVRMCSNDTEFYSYVEF
PLGCTKEGVEYRLVQAAYKQKPGRRLAQALGMSEDDDVLFVVFSQGQKNRSSPPRETLLC
LFTLHHINLAMRERIRSCYRGDGRLSLPWLLNKELPCIHTPQQIGDDFCGLVLNQPLGGL
RAIEGTPLYEEREEGLGAVAGYVYGEHTVVFVGTRSGQLKKIRVDGIPPPSQNALLYETV
TVGEGRPILRDMVFSPDHQYIYLLSNHQVTRLPVESCHQYNSCKACLGSADPHCGWCVLY
HKCSRQEACKKWEEPQHFNTRLDQCVDITVTPSNISVTSXXXXLTVRVQNIPALTGGVSC
VFEDLSETLGEVVSRGEVLCRSPSLRDAPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXCTACVSSVFSCHWCKYRHICTNNLLDCSFQEGKVSKLEGCPQILPGLDIL
VPAGLVRPITLRALNLPQPQSGQKNYECVFSIQGSSQRVPAVRFNSSCIQCQNTSYWYEG
DEVGSMAVDFSIVWDGDFFIDKPPAMKALLYKCAAQRSSCGQCLKAPTTFDCGWCTESRK
CLLRQHCPAPEVNWMHHGRHNLRCSHPRITKIGPLTGPREGGTRVTIEGENLGLQVREIA
HVQVAGVRCTPAPAEYISAERIVCEMAEALLPLSPGGPVELCIGVCSSEYRTLSTQTYSF
VPEKGPVSGGTRLTVWGRQLDAGSSVRVFIHQEPCLFLRRTSRDIVCITPASQSGSGPAP
IRLMIDRAEVTSETRFLYSDDPTISSIEPNWSILNGSTVITVTGANLLTIQEPKVRAKYN
GIETTNLNDSVMTCLAPGLLYDQLGPLEGPLHPDEFGFILDQVTSLLVLNTTTFTHYPNP
TFPGTSGILEVKPGSPIILKGKNLIPPAPGNSRLNYSVLIGETPCLLTVSENQLLCDSPD
LTGEQRVLILVGGLEYSPGTLHIYSDSALTLPAIVGIGGGGGLLLLVIIAVLIAYKRKTR
DADRTLKRLQLQMFAELQTDIQELTNMDGVKIPFLEYRSYTMRVMFPGIEEHPVLKELDS
PANVEKALRQFSQLLNNKVFLLTFIHTLEEQRSFSMRDRGNVASLLMAALQGRMEYATVV
LKQLLADLIEKNLENRNHPKLLLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXVTDGSLVALVQKQVSAYNIANSFTFTRSLSRYESLLRTSSSPDSLRSRAPMITPDQ
ETGTKLWHLVKNHEHSDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTAHR
GSALPLAIKYMFDFLDEQADKRQITDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSS
ITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYRDISKLPSIS
DQDMDAYLVEQSRLHGNEFNTLSALSELYFYINKYKEEIVTALDRDSYCRKHKLRHKLEQ
AINLMSGNS
Download sequence
Identical sequences ENSGMOP00000010771 ENSGMOP00000010771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]