SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010776 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010776
Domain Number 1 Region: 184-380
Classification Level Classification E-value
Superfamily Fibronectin type III 5.97e-36
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 2 Region: 384-485,572-667
Classification Level Classification E-value
Superfamily Fibronectin type III 4.38e-27
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 692-786
Classification Level Classification E-value
Superfamily Immunoglobulin 8.11e-21
Family I set domains 0.0059
Further Details:      
 
Domain Number 4 Region: 485-584
Classification Level Classification E-value
Superfamily Immunoglobulin 3.03e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 2-90
Classification Level Classification E-value
Superfamily Immunoglobulin 5.26e-16
Family I set domains 0.0053
Further Details:      
 
Domain Number 6 Region: 99-192
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000977
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010776   Gene: ENSGMOG00000010082   Transcript: ENSGMOT00000011074
Sequence length 788
Comment pep:novel genescaffold:gadMor1:GeneScaffold_748:781623:788135:1 gene:ENSGMOG00000010082 transcript:ENSGMOT00000011074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFVSGLSDVNAILGGTAEIMCKVSSEDCEGAWFKDNQKLSANDDFQITKDGSTHKLIINN
CKEVHSGKYRFEADGRKTEAVIYVKDPPRFTEEDLSVFSKPVVIKVGQNAVFQLPFHGQE
PMKMQWFREGEELLEDHGVRIERGHAHSRLLLSRCSRKNAGEIKFRLRNDHGTTEVITQL
VVLDRPTVPQGPAEVVDSSPTAIEFKWRPPKDEGGCPLVSYALERRQVGRNTWKKLGEVP
AVAGYRDNDVEHGRKYCYRIRAVNAEGVSDVMETDDLQAGTLAFPGPPSPPKVVAASKDC
ITLSWAPPTFTAGSRVLGYSLEKRKKGSNLWSSVGDLITGKTHAVKDVVESMEYEFRVAA
VNQSGVGEFSNPSEFVFARDPKKPPGKVTDLKVTDRSYTHLSLAWTKPEAVAGLLDEARG
YHVEIRPAECSEWSRCNVTPSILPSYSVKGLRSMEMYWVRVFAANEGGESPPTELQNYVL
VMPLPVRPRFTDQKMKSFMVVRAGNSVRITVNFEAMPLPQVFWLKDNVPVAKRVNVSNCD
SSSQLLIPSSERSDTGVYSITVKNLVGQETFSLEVRVTDDPKPPGPITLEEKVPGTVTVS
WEPSPDEQRDDRLHYSVCALDSSRRTWSTAAERLFNNQLTVCNVMQGREYHFWVYAKNDM
GTSAPSVSPTWGTERKKERFVVHAPTRKDPDPRCAPSFMVPLKCHTAPKGYECYMSCAVK
GNPKPRVTWYRNNVSLNTNTNYYISDICGVCSMLILRVTPKDVGEYTILAENALGRAECS
TTLIVIGE
Download sequence
Identical sequences ENSGMOP00000010776 ENSGMOP00000010776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]