SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010791 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010791
Domain Number 1 Region: 412-575
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.83e-49
Family G proteins 0.0000266
Further Details:      
 
Domain Number 2 Region: 4-95
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000149
Family Polcalcin 0.076
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000010791
Domain Number - Region: 219-274
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0196
Family Mitotic arrest deficient-like 1, Mad1 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010791   Gene: ENSGMOG00000010090   Transcript: ENSGMOT00000011089
Sequence length 576
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1541:5382:23169:-1 gene:ENSGMOG00000010090 transcript:ENSGMOT00000011089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALEQERLRTLFHAYDANHSGRIEKCEFLTLCSELGVSVSEAERIFDQLDVDQDATVTL
DEFINGFQERYVNGPDAGGDGSVAWEDFERRLGEQAMFIPRKEQAATLYQNIRLTEPRLM
QQYERVILNFTKEIRQHNGEMENLALAVKRAQDQATMQLSEMEEEMDHRIQAAEKKSRHQ
ETLRTEAALNELRRSYETEICELQCKIQRMQVIEEKFKNMSNRDESFSLKKRINELTIEN
QRLKQDLMKSQTNIACLQSEMDSLKTDLTDQSMNSERDEEMMKVVSDERDSLERQIEVLQ
LANRKLHDSNDGLRTSLERGNKANRSKSICYSSPYALIDSRRPSCDALALAMCDPGLRRR
HSSECEEDSLPESCMDSGLSTLRGSRGEYDSEPEVKEEEKVEGDCVELGFMSSEKAYRIV
LAGDAAVGKSSFLLRLCKNEFRLNGSATLGVDFQMKTLTVDGEPTVLQLWDTAGQERFRS
IAKSYFRRAEGVLLLYDVTCERSFLNVREWVDMIEDLSHDDIPIMLVGNKCDMRQQGIVC
VPTSYGEKLAMTYNAMFCETSAKDGSNVLEAVLHLA
Download sequence
Identical sequences ENSGMOP00000010791 ENSGMOP00000010791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]