SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010807 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010807
Domain Number 1 Region: 209-349
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-37
Family Third domain of FERM 0.0034
Further Details:      
 
Domain Number 2 Region: 106-211
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-30
Family Second domain of FERM 0.0000661
Further Details:      
 
Domain Number 3 Region: 24-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.1e-27
Family First domain of FERM 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010807   Gene: ENSGMOG00000010103   Transcript: ENSGMOT00000011105
Sequence length 603
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1541:38259:75421:-1 gene:ENSGMOG00000010103 transcript:ENSGMOT00000011105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNDRRMKMLRFRSPSIRSLDQETLCTIRLLDDSEISCSIQRDTKGQFLLDHVCNHYNLLE
KDYFGIRYVDPEKQRHWLDPSKPVVRQMKAQQPYMMCFRVKFYPNEPMKIKEELTRYLLY
LQLKRDVYHGRLLCPFADAAYLGACIIQGELGDYDPDEHPSDYIRDFKLFPKQSLKLERK
IIEIHKNELRGQSAALAELNMVQRAHTLETYGVDPHPCKDFTGSTAFLGFTATGFVVFQG
NKRIHLLKWADVSKLKFEGKTFYVIGIQKEKKLVLTFHTSTPAACKHLWKCGVENQAFYK
CAKSSQIKTVSSSNIFFKGSRYRYSGRVAKEVIEASSKIQRDPPTVRRAQFGQSRSYNSL
SHKNLIMNMEPLVPALPSTNEYEETATDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTS
KPELDEEDEESSNEALTISELVYSPCASMLPTPVEDNQGGVDLLFSSPVQSPAWLLRELH
ADPDIQAQLEAERERDRAYERVRQAGRSRVGGVLSSGLRLLSSNERANACLLSVARFVAV
VTGVLLVVVPTLLLLLESDIDVSFLHEIRQTPEFQQFHYEYYCPLRRWALCKIGKALEKL
WSD
Download sequence
Identical sequences ENSGMOP00000010807 ENSGMOP00000010807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]