SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010824 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010824
Domain Number 1 Region: 33-144
Classification Level Classification E-value
Superfamily EF-hand 0.00000804
Family Calmodulin-like 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010824   Gene: ENSGMOG00000010119   Transcript: ENSGMOT00000011122
Sequence length 168
Comment pep:novel genescaffold:gadMor1:GeneScaffold_748:875417:876808:-1 gene:ENSGMOG00000010119 transcript:ENSGMOT00000011122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQRQGVEGDPDKTICVAEIQWSKKLLFECLFHELKSLFDVTNNKEAADEFDNVFAFDNG
DNNIDFLEYVASLNRVLRGMLDPTQWYFLLMMSTGLKKACHGELDQCNLDHDQVVDWTSE
LVDKNEDGELYLDAFMDRAGRDKWVSKRLRMDLNLKDWMKGPECSADF
Download sequence
Identical sequences ENSGMOP00000010824 ENSGMOP00000010824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]