SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010919 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010919
Domain Number 1 Region: 1342-1519
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.11e-42
Family DBL homology domain (DH-domain) 0.0000595
Further Details:      
 
Domain Number 2 Region: 1529-1644
Classification Level Classification E-value
Superfamily PH domain-like 3.11e-35
Family Pleckstrin-homology domain (PH domain) 0.00057
Further Details:      
 
Domain Number 3 Region: 937-1077
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000816
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010919   Gene: ENSGMOG00000010173   Transcript: ENSGMOT00000011217
Sequence length 1753
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1933:62825:81555:-1 gene:ENSGMOG00000010173 transcript:ENSGMOT00000011217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPQSLDSSIQSALSALFPPFEATAPIVLSQLFRTIEERYHGDALQCLLDFLIPSKHILES
VQQAACAAYSDVIFCHEGWPLCLHDQTVIHLAPLNPLLLRPSDFYLQVEPFGEQAARIVL
KSLLAEGCREVEETPILETSYPCIFTEDWLRDINEGRHGTPLTRCLLSTDQGVIKLPWAK
VAIPEFIEKPKPTVPSSLPLARDTPPEPRRLLTPSHYNSSTLPMGALLPRRDRMRASLRI
PEDSSKLVKVHNDRPAPKTCPKPSPKPIGWVSPNTWDCQNYREIEGDYVDLVDLVKDKEA
LAKLDNHPNPPGSISFKPVRPPPPVPVANGSGVGGRSLRYGEGAFPPCSQKRLSYEMSEQ
EMKCRYRDSYTAALKNPVAFERGSAELLAALKEFGFQSPEDFGPNGRFVTHGDHPGHSLN
CFKDYEPNKEPQRRKACCRMPESIESHAKEPADVSETLTKELQLDEKFASGGIPRQKVQT
DILIPHQKGQKCEDNIIPHHKAEVLKPPVKFKAKLRSLSTVSESPKGSPILYKLNNRSHS
DICPEMIPSIIHYKQNAGFSLATQKEEVRHSPKKGKSATKSCTIFRRLWPINHIKRGGFS
MEVIKALRDVSVEGRAIYSPEGISSSAVWFLSTINITHVIVDREYRNSWHTTKSNTDGSY
LKLHDVKTDKPLPSPREPQPSVCPAVPSAPQSQEATLRSIVGLLQLGTICLPGGRDKTGR
AVLEVHGERAMWTAPLASAPHLCRLILYMSLIPRKEVRDLGMTLVIDARKRPPPPLLYKA
LLMAQEQALHAVHSILILVDKDTVPRPERQPGLQMDVVTSLKALNKIVEASQLTSDLGGT
FAYSHTDWLQLHQRLVSFTTDLQGADSLLQKAIKKVDETKSMDTAQEVQQCIQEQRTSMK
EVLENSRLVSLQREGGAILARFRREDLRFQQSEDSRDAVEAVTSLYNQLEEKLHTLVMRS
NESLQHLQHLFRLREVEGHINAAGIWFNREGELTLKDNSTLDTLKDSETALQHLDAFLTQ
AMEKKQVALALMLEAQNIVDTSPPSPATDVFRTVVSTFKSNMDDLLHRAEPKRKELDVLT
QLHRFCEQASAMAEECVPYLEQVEGECYLTEATQSTLNKYEERFSADLSSPHFQAVKTQA
LGLGPRASGVLRAWNAAWVQCQKVRQRLGEWEDEADNQNQAVPAAASQGEEEEAEDVEKR
RKSAEAGGLLTRGSPASSTEVNKTRGGRRRRGCHVANRRRQKEHHSDMDLRRVDSFGQGE
ESPSHQGLGRSLSEGSCVNPSLTSFPSPPSPFDRDQRQMRRQTLGPSVLPVHTSTSISSH
HSFCLGDLRVESDSEGKGGRGKLRKILEELLCTEREYVRALGYVGEHYFPELERADVPQD
LRGQRGVIFGNLEKLHDFHRHTFLKELEGCAENPLRVGRCFLRHRENFALYALYSKNKPR
SDALLVHRGQDFFKQKQLELGDKMDLWSYLLKPVQRISKYSLLLHDVALECGPGHARERA
ELSAALEVIHFQLRHGNDLLAMDDIHSCDVNLKEQGQLIRQDEFLVTFRKKKCFRHVFLF
RDLLLFSKTKKTGVGNDVYIYKQSFKTSDLGMTHNSGCSGLCFEIWFRRRKSQDTYTLQA
TCREVKEAWTKDLTRILWEQALHNRELRMQESVFMGIGNKRFMDIQPSDAAIKDRAINYV
RMGRGRSLCSSSSSSIGSLSPAGYLGGSKRALEGPSGALKEGDLDHNSKNCLLMDSSESS
GDSVSVLSQSTHS
Download sequence
Identical sequences ENSGMOP00000010919 ENSGMOP00000010919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]