SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010924 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010924
Domain Number 1 Region: 199-351
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-30
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-22
Family Second domain of FERM 0.0015
Further Details:      
 
Domain Number 3 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.72e-21
Family First domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010924   Gene: ENSGMOG00000010202   Transcript: ENSGMOT00000011222
Sequence length 934
Comment pep:novel genescaffold:gadMor1:GeneScaffold_748:955684:966807:1 gene:ENSGMOG00000010202 transcript:ENSGMOT00000011222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGRLCQVHLLDDRKLELLVQPKLLSRELLDLVSSHFNLKEKEYFGLTFVDDNGQCKWL
QMDRRVLEHDFSKKSGTISLKFLVRFYVESISQLKDIITVELFYLNAKYAVYQGIIEVES
ENVFRLAASALQEAKGDYTSDENTRADLKKLPVLPTKVLKEHPSLAYCEDGVIEHYKQLK
GLSRGQAVVRYLTLVESLPTYGVHYYEVKDKQGMPWWLGISYKGIGQYDLQDKLKPRKLY
QWKQLENLYFREKKFAVEVNDPHRSRRAVTKRTFGQTGLLIHTWYASHSLIKTIWVMAIS
QHQFYLDRKQSKGKIGSAKSLEEIAMDLTEQGGSKISRLGDTGLKNNHIMASNGSLVSTG
SADSEASEEQKREKISELRKKEQEIQEVLAKKTKELRKICLREAELTGKLPKEYPLSAGE
RPPQIRRRVGTTFKLDDLFPYNEDPYLRNLESRFALQRKIVEAAKKLANEAELCKTVKKK
RRRNCLDAMHKLQQVEDEMNQYRIKKGKKPTQRASLIIADELVRSDCSSLSSLPLDDDDS
DSSSQRPRSRSVQGSPQLSPMRSLGAEYEADRQASSNHHQKNLSSPREVSSSGSSPYKTL
PRPAKDPRSMPPTPVMTRNAYSSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXYESPAHYAPDAFYGAGYPGADAEPYSNGAYVYESDVEGHYNVNPSY
QVNGYHGHERYRHYSDRSDNLSQNPYATMRPPRSRTGPRNELLAKSMQKALVAEHLRGWF
HRSGAQKEPGRGPFDYDTGSQLSLGYQTLPAPFSHSSRTNSYSSVSSATSTGAWRNHLAV
GLTDYDSADRAQYQQQPAGAAPGAANSRSPTHSR
Download sequence
Identical sequences ENSGMOP00000010924 ENSGMOP00000010924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]