SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010957 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010957
Domain Number 1 Region: 77-193
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.19e-35
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010957   Gene: ENSGMOG00000010243   Transcript: ENSGMOT00000011255
Sequence length 205
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3746:411415:413959:1 gene:ENSGMOG00000010243 transcript:ENSGMOT00000011255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEADAAVASDPPSSQDIAAIQDEDVLNKMLDKAVDFEERKMLRAALRELLKTKRDKREKD
RGSRQEDMKGLNQRGQPKSPTAAAPNTKNVKQMLLDWCRAKTEPYEGVTIKNFSSSWSDG
IAFCALVHRFFPDAFEYSTLNPNNRRDNFELAFTTAEKLANCPPLLDVEDLLRMAEPDWK
CVYTYIQEFYRCLVEKGLVKTKKRT
Download sequence
Identical sequences ENSGMOP00000010957 ENSGMOP00000010957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]