SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010983 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010983
Domain Number 1 Region: 4-129,281-464
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.32e-33
Family WD40-repeat 0.019
Further Details:      
 
Domain Number 2 Region: 380-604
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 8.89e-16
Family Tricorn protease domain 2 0.036
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000010983
Domain Number - Region: 665-759
Classification Level Classification E-value
Superfamily EF-hand 0.00229
Family Calmodulin-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010983   Gene: ENSGMOG00000010257   Transcript: ENSGMOT00000011281
Sequence length 762
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3797:64259:134031:1 gene:ENSGMOG00000010257 transcript:ENSGMOT00000011281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHGGPISCLCMSEDRRWLGTADNGREPLLIIWDSYTGIPVHTLFNGPTEGSVIALAFSKD
AKYLATLGGGEQQCVHIWDWTNEQDTPLWVANLYSELGFQSYIIFNPGDSTELLSNSDSQ
VLFYKAFQTEGNLEYIAPYLNDKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXWIVTGDVLGHIKFYDENFRLMSWYSDFSLDAIASISFS
KDAAPEPSQDYPESCILADQPFVSRSFVVSTVRATVVHVKTPGGGPQTLLREHCAPLHAV
ACHPRRPILAMGSHSGILKVCDYNTKLTLASRVYESERIQCLIFDPQGFYVAVGFASGAV
HILDASSLHSDAEDCFHFSDNSITHITFSLDSMYLATADTGKAVTVFHLHSSLAQWQLVG
RHISHYKPIRELLFGVHLDSTRPRLLSLAMDRRLVEYDLDSSMEQQLLVLSAERVEQSAV
PQCMTWYPPLSTERFLLTASDQHKMKLLNSTTNMCSRKTLLGPTYESPVQKMVVLPGSSY
TYYLAFITKDKVGLQILPLDGNPYKPGGVCHPGGVSQLVCSFDGRFVFTSGGADGTVLRW
RINPHHHSALQATAALGGSHLDPFYALLEGGRGGTLCREMEDLFYYCQLRHQGIDSMAPR
QVSTSIPLTEVPFLMRALGFFPSEQELEDMQNEVKFSKYAETGKYVKEVDLAEFLRLYIN
HRPAFGISRKELAESFRVLGFWDGSGRMAIPRDQLLELLQAR
Download sequence
Identical sequences ENSGMOP00000010983 ENSGMOP00000010983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]