SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011007 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011007
Domain Number 1 Region: 216-324
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000368
Family V set domains (antibody variable domain-like) 0.032
Further Details:      
 
Domain Number 2 Region: 133-211
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000462
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 15-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000271
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 371-433
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.000000667
Family Toll/Interleukin receptor TIR domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011007   Gene: ENSGMOG00000010282   Transcript: ENSGMOT00000011305
Sequence length 686
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3176:68:223001:1 gene:ENSGMOG00000010282 transcript:ENSGMOT00000011305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVDGCTDWSVDYLKYKVLLGEPVRIKCALFYGYIRANYTHAQGAGLSLMWYKSSGHGDFE
EPISFDGTRTSKEEDAIWFRPAELEDQGHYSCVLSRNSTYCMKVSMSLTVSENDTDLCYN
SLMRFSEKAELSKNKEITCPGIDDYIQPGVEPEITWYKECKPKQWRPTVLRTRDTLSIQE
VLEDDIGNYTCELQFGSFLVRRTTELSVTAPLTDKPPKILFPSENQVSIMEMTIGSPVNL
TCRAFFGYSGDVSPLIYWMKGEKFIEDLDEERIQESDIKTVREHLGEQEISIYLTIDSLG
EGDLGNYSCYVENGNGRRQANIQIIRRAELVYTMELAGGLGAILLLLIVLVTVYKCYRID
LMLFYRNHFGSEDVDGENKDYDAYLSYTKVEPDQWSQETREEERFALEILPDVLEKHFGY
KLFIPDRDLIPTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVSAISMAAATTTAMATAGHPTLRASFHSSQCHAQVR
QQKHYYHHGGYDYDLPQHGGTLPSLSSLGGGQQHTYCNIPMTLLNGGQQRGGHSARSPRQ
RSLEEAGDNAMLPLLPRETSISSVIW
Download sequence
Identical sequences ENSGMOP00000011007 ENSGMOP00000011007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]