SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011010 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011010
Domain Number 1 Region: 110-693
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.06e-186
Family Myeloperoxidase-like 0.0000000000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011010   Gene: ENSGMOG00000010286   Transcript: ENSGMOT00000011308
Sequence length 696
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3746:473803:478168:1 gene:ENSGMOG00000010286 transcript:ENSGMOT00000011308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEEAKKLVDDAYKYSRDESLSRVRREVVSPADILRLMKQPRGASRSAVRSADYMDQTLRL
LHDRVHRVHKRSLNATDLLPREDLEVLSKISGCAAMVSDPPCRTTQNLDKYRTATSVCNN
PRLGASNTPFKRLLPAQYDDGVALPNGWERSRRFNNFVLPLVREVSNRILATPDEGVVND
TEFSHMTTLFGQWNDHDLTFTPFSPSIRSFSNGLNCDESCERSEPCFPIQIPPGDPRLPT
GPDSCIPVFRSAAVCGTGNSAFNFGGVANKREQINTLTAFLDLGQVYGSEEQLAMDLRNL
TTDAGLLRVNDKFRDNGRELLPFSPLLPKMCATRQRVTNNSKAEEVPCFLAGDVRVDENI
ALTSLHTLFMREHNRLARELKKLNPQWDGETLYQEARKIMGAYTQVFVFRDYLPHIVGDV
AMSRLLGRYPGYDPNVDPSIANVFATAAYRFAHLAIQPFLARLDQNYRENARIPNVPLFK
AFFTPWRIVFEGGIDPLIRGLAGRPAKLNAKKPVLVNALRERLFQFVMHLALDLGSLNMQ
RGRDHAIPGYNAWRKFCGLSQPGNQAELARVLNNAGLATRLLQLYGTPSNIDVWLGGVAE
PLVQGGRVGPLFACLIANQFKNIRQGDRLWYENQGVFSPSQRNVLRTASLARIICDNTGI
SSVPRDPFSLLSGSNRLVRCSDVTSMTLLPWRERPN
Download sequence
Identical sequences ENSGMOP00000011010 ENSGMOP00000011010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]