SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011087 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011087
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Sema domain 1.57e-42
Family Sema domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011087   Gene: ENSGMOG00000010367   Transcript: ENSGMOT00000011388
Sequence length 184
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2049:18006:20082:1 gene:ENSGMOG00000010367 transcript:ENSGMOT00000011388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSIAASAVCAFNLSAITRAFNGPFRSQENPRSTWLPTPNPIHNFQCGTIEDGGGPNEGLT
ERSLQEAQRLYLMNDVVQPVSVDPLVMQDDVRFSSLVVDIVQGMDTLYHVMYIGTEYGTI
LKALATTNKSLQGCYLEEMELLPPGVHEPILSLQILHSDRSLFVGLSDRVLKIPLERCST
YTTE
Download sequence
Identical sequences ENSGMOP00000011087 ENSGMOP00000011087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]