SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011164 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011164
Domain Number 1 Region: 93-211
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000012
Family Second domain of FERM 0.007
Further Details:      
 
Domain Number 2 Region: 232-305
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000553
Family Third domain of FERM 0.012
Further Details:      
 
Domain Number 3 Region: 3-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000599
Family First domain of FERM 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011164   Gene: ENSGMOG00000010426   Transcript: ENSGMOT00000011465
Sequence length 311
Comment pep:novel genescaffold:gadMor1:GeneScaffold_571:38061:41943:1 gene:ENSGMOG00000010426 transcript:ENSGMOT00000011465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVRRVCVVLSNKQRLDCIVRVSSIGRQVLDHVTLMCGVRSLQIFGLAIFLEHEYLFVDLD
QNLGTYFGKEWRRTSTKVSGTFLLFLKVQHYVESVELIKDSTSQELYYSDLRRKMLDSLC
DQQELLFLQLAAAALQAEMGDAEEQILGDGDEQNGKEKRNKNYFLPEDYFPSWLIRHRGR
DFLLRHAGALHTTLRGLVRPRAIRRFIEDASALQDVPVTVYTLRQDKRDVRGCVHLAVTL
KGLCVHQEVEGKLHLLYDCTWKEIHSLTFRGKRFEVRPGGGLGLTVYYTASPCHSRLLLR
HSSHRFQLDNR
Download sequence
Identical sequences ENSGMOP00000011164 ENSGMOP00000011164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]