SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011191 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011191
Domain Number 1 Region: 12-88
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000134
Family I set domains 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011191   Gene: ENSGMOG00000010456   Transcript: ENSGMOT00000011492
Sequence length 89
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2002:402641:410118:1 gene:ENSGMOG00000010456 transcript:ENSGMOT00000011492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPRPPGVHGLREEPRFVTARAGETVILGCDVSPPLDGQQPPYVVEWFKFGVPIPFFINFR
YYPPHVDPEYTGRASLYGKASLQMDPVRS
Download sequence
Identical sequences ENSGMOP00000011191 ENSGMOP00000011191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]