SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011250 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011250
Domain Number 1 Region: 1074-1418
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.12e-91
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000446
Further Details:      
 
Domain Number 2 Region: 891-1066
Classification Level Classification E-value
Superfamily ARM repeat 6.91e-50
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00036
Further Details:      
 
Domain Number 3 Region: 400-549
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.75e-32
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 4 Region: 1448-1567
Classification Level Classification E-value
Superfamily PX domain 4.45e-26
Family PX domain 0.0013
Further Details:      
 
Domain Number 5 Region: 1586-1711
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.32e-23
Family Synaptotagmin-like (S variant) 0.0012
Further Details:      
 
Domain Number 6 Region: 713-828
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.17e-21
Family Synaptotagmin-like (S variant) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011250   Gene: ENSGMOG00000010481   Transcript: ENSGMOT00000011552
Sequence length 1715
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1404:15729:71574:-1 gene:ENSGMOG00000010481 transcript:ENSGMOT00000011552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTSSGNGFKLDVPQPKGIVGKEEALRMEEEAMAKCQKEKQHSLSASSRLSSSAPSSSS
HRLMASSITTPPQSSTRPERDLIVFPETKKPAGSDKFSDIDVEKLTNEELEKLLLDDNFG
TSSSKATRPSSLLGFNLSASYPGGHACSHSPFQTGPWTPVISTTSGSGVSTPTNQQAPLF
PSAPFPKPVSFQNGFPPGMSPFMGLTAPQPSFMGFTPIQTAAPLVYQQPPVDPVMARLFD
KIASTSEYLKNGRLASMDVDSAPGPALSPAHPAAAEEPTTVSHFEWLDLDPLTRRRDESE
ETPGGGTAAGDSAGDPWDAVLETEGSRGSSSPTSEAKPPLSTQAQPRRASTGASGGAAMT
RGHPLSPPSTSSQQLPNNQVGFQXXXXXXXXSSVGEPSALQEPEAQNLEAVAFCTEVAML
RSRFPHGDVSTNPGYILSPVIPQRDGGDGGCSVKVSIEISDFQEPVTFTCDVSSPVELLV
SQTLCWVHDDLDQVDFSCYLLKVCGQEEVLQNKHSLGSHEYVQNCRKWESEIRLQLLSQS
TMRRDLARTAEDESSPIDLEKHLTLVERPFKENVTRQGLSDYLEGYHKQVTMCLQNESTQ
YKTLERVIQTVKNLCSALDAVETQPITEAVKRLRHQANLPQARSPDSVLESPLTPAGNGS
PVQEGMAQLTEAVYDLARLYLRSFCPVAPSFSPPPPTAREGRAAREASGTTDHLQFTVFA
LHGIPAPWISSYEKYYLTCSLTHNGRNLFKPVQSKKVGTYKSFFYHIRWDELIIFPMAVA
VLPLESVLSLSVFGLLNQNATSSPDSNRQRKGPELLGKVSLALFDFHXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVDFPSPSAEVLYVGPPAAPSPEPDTLEELDPDLRRK
LEKICSRASTFGLKRADYQLLWDQRLYCRRDNPSSLPKVLAGAPSWDWASLAHIHSLLHL
WAPLAPVTALELLDAKFADTEVRRVAVGWIEVSTDDELADYLPQLVQALKFECHLKNALV
MALLSRAQGNINIAHYLYWLLRDALEDQAWSRRYEQVLGALMCLCGAGLRAELDRQTSLV
NLLAGVAERVRQAGGSARQVALQEGLENVQTFFQRNSCRLPLSPSLVAKELNIKACSFFN
SNAVPLKLALVNADPLGEEINVMYKVGEDLRQDMLALQMIRIMDRIWLQEGLDLRMVNFK
CISTGKDKGMVELVPSSDTLRKIQVEYGVTGSFKDKPLAEWLRKYNPAEDEYDKASENFI
YSCAGCCVATYVLGICDRHNDNIMLRSSGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTS
DMAYVINGGERPTSRFQLFVDLCSQAYNLIRKHSGLFLNLLSLMTSSGLPELSGSQDLKY
VFDALQPHTTDAEATIFFTRLIESSLGSMATKFNFFIHNLAQLRFSGLPASDEPILSFSP
RTYSLKQDGRVMQASIFSFQKRYSPDKHYTYVVRLLREGQNEPQFVFRTFDEFQELHSKL
SILFPLWKLPSFPNKMVLGRTHIKEVASKRKLELNNYVHNLLRSSTEVTQCDLIYTFYHP
VARDDKTEGVEATPKAPEPPLSPTGGRVEGEVKVSVSYRNSNLFIMVMHIRDLVSEDGTD
PNPYVKTYLLPDPHKTSKRKTKITRKTRNPTFNEMLVYSGYSKETLGLRELQLSVLSAES
LRENFFLGGITLRLKEFDLSKETVKWHKLTAVPYF
Download sequence
Identical sequences ENSGMOP00000011250 ENSGMOP00000011250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]