SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011264 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011264
Domain Number 1 Region: 10-65
Classification Level Classification E-value
Superfamily EF-hand 0.000000202
Family Parvalbumin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011264   Gene: ENSGMOG00000010526   Transcript: ENSGMOT00000011568
Sequence length 67
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2365:336:1627:1 gene:ENSGMOG00000010526 transcript:ENSGMOT00000011568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDPPFDQVGLSRSAEDTGERVFTVLDQGKSYIEEEELKVFLQNFSTVLSRALLAAGDKDG
DGKIRMA
Download sequence
Identical sequences ENSGMOP00000011264 ENSGMOP00000011264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]