SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011332 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011332
Domain Number 1 Region: 806-1095
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-67
Family Protein kinases, catalytic subunit 0.0000116
Further Details:      
 
Domain Number 2 Region: 529-808
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.97e-43
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 3 Region: 383-491
Classification Level Classification E-value
Superfamily SH2 domain 8.3e-18
Family SH2 domain 0.0033
Further Details:      
 
Domain Number 4 Region: 269-369
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000344
Family Third domain of FERM 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000011332
Domain Number - Region: 133-239
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00157
Family Second domain of FERM 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011332   Gene: ENSGMOG00000010571   Transcript: ENSGMOT00000011637
Sequence length 1112
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1669:7525:40553:-1 gene:ENSGMOG00000010571 transcript:ENSGMOT00000011637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPVEDESVPLMGRAREDSVRSGSITPPRIQLHLYFIPSTKNAVTIDLRFGPITAENICL
EAAKKCGILPVYHSLFALSSSDLSFWYPPTHVFNLENHTLVHFRVRFFFSNWFGQSPRTS
YRYSLTRDRITPVLDYSVIDYLFAQCRRDFIANEGGVSPPLSVQEECLGLAVLDLWRMAK
ERNQSVREVCNSVSYKSCLPKLHSMDLQRRNRLVRYRIRTQLKCLLKKLGSCSVDECSLK
LKYLMELAAIEPSLGSETYAVNRSGRLQPHLRVTGEAGIQTNGRRHPGEKLWQTFCDFQE
IMDISVKRVCEDQGPPEQGPQDASVVTVTRSDDRPLEAKFQSVTEALSFVSLVDGYFRLT
TDSNHFFCQDIAPYSLLENIENRCHGPITSEFAVNKLKKSRKTRGAFVLRQSPMQYQNYF
LTVCVEQTSLGLDYKDCLISKSNEEFTLLGVQKSFYSLTELTNHYKHNMLLLADVPVKLS
CCCPPRAKEFTNLIIVRDSRAVQTQGSAKPEPNKFANIQFQMIKYEAPDECLGQGSFTRV
FKGTKVDIREGEEHRTQVLLKVLDANHKDYWEAFFEASSMMSQISHKHLLLVYGVSVHGA
KNIMVQELVKYGALDLYLKRKGSVSVSCKLDIAKQLALALNFLDEKNIVHGNICAKNVLL
AREGDPSQETSPFIKLSDPGIKVSLLDRNVILDRIPWVGPELLQDPPILSLDSDKWSFGA
TLWEIFNNGETPLKDWDLEMKRRFYGTYQQLEPSQWTELADMITQCMDYQPASRPSCRVV
IRQLNNLITSDYEVLHASEAPESPRMQCSRHPAQEQTPVFEERYLRYISLLGKGNFGSVE
LCRYDPLGDNTGELLAVKKLQPSKRSFLADFTKEIKTLSVLRCDYIVRYRGVSYSTGRLS
MSLVMEYMPHGSLSGYLEKNASVGLGRMLLFASQICKGMEYLQSKRYVHRDLAARNILVA
SDSLVKIADFGLTKIIPDDKEYYRVTQPGESPIFWHAPESITESSKFSHKSDVWSLGVLL
HELFSDCNRHQSPKRLYMQRISSNTQGPAIPMQLLFVLKDNWRLPAPAHCPARVYALIRQ
CWAYSPEDRPSFSSLSDQIHSIAQEETLSRAS
Download sequence
Identical sequences ENSGMOP00000011332 ENSGMOP00000011332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]