SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011422 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011422
Domain Number 1 Region: 2-722
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.19e-224
Family Motor proteins 0.00000000285
Further Details:      
 
Domain Number 2 Region: 2042-2154
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000196
Family Second domain of FERM 0.016
Further Details:      
 
Domain Number 3 Region: 1595-1684
Classification Level Classification E-value
Superfamily SH3-domain 0.0000541
Family SH3-domain 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000011422
Domain Number - Region: 2155-2245
Classification Level Classification E-value
Superfamily PH domain-like 0.00123
Family Third domain of FERM 0.068
Further Details:      
 
Domain Number - Region: 1957-2038
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0114
Family UBX domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011422   Gene: ENSGMOG00000010621   Transcript: ENSGMOT00000011732
Sequence length 2269
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2519:44778:102322:-1 gene:ENSGMOG00000010621 transcript:ENSGMOT00000011732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELHEGAVLLNLMMRFDRELIYTYIGSILVSVNPYKMYNIYGTDMVLQYKGHALGENPPHL
FAIVNASYTKMMDAKHNQVIIISGESGSGKTEATKLVLRYLAAIHHKNNITQQILEAAPL
LESFGNAKTVRNDNSSRFGKYIEVFLEEGVISGAITSQYLLEKSRIVFQAKDERNYHIFY
EMLAGLPSQQRQAFYLQEAETYYYLNQGGDCGITGKNEAEDFLRLMAAMEILHFTPEDKD
TIFRLLSCILHLGNVFFQRYETDGQEVASVVSAQEIRVVAELLQVSPEGLQKSITFKVTE
TMREKIYTPLSVESAVDARDAVAKILYSLLFHWLTEKINAQVYPRQHSLSISILDIYGFE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEYSREQVPWQDIQFSDNQPCIDLIAAKPH
GILRILDDQSCFPQATDHTFLQKCHYHHGNDPQYLKPKMPHPEFTIKHFAGRVTYQVHKF
LDKNYDQVRQDVLDIFIQSKNKMVSGLFRRHSEVAAEQRGGQGRKSSTVTRRYQASTVSH
KFQTSLLELVEKMERCDPLFVRCIKPNNLKEPGVFETELVSTQLRYSGVLETIRIRKEGY
PVRLPFAIFLFRYKSLVALKDPPPTSGESCVIMLSQLCPLTAGCFHVGVTKLFLKEDIYQ
LLECKLERARQLAALTLQRTARMFFARRRFVQFRMRIIGLQAQCRGNLTRKHYVKRRAAL
VRFRTIVRLYVLQVLYRREVVNVTHLVISADLAALLHTVAVGRELHSDCLALLQAPHIRE
DTQLTLPLDINNYPFYRYVQAYFREPKFGMLTDPLEASLTRVDEDLKEAALELFTLVLRF
MGDPHLNGAQENMFGSYIIERGLSSPGLRDEILAQLANQVWRNVNVENAERGWLLLLGCL
CAFAPSPKMEKHMLKFVSDHAPIESQALLQHCLIQANQKSLLSSGSNPETARTYPLSLLE
WTANRKKASMVLQVHCFDAMSFLCPVNSWTSGEELAGVILRHRGVTEWWKGYSILMKEQG
QWVELAGHDYVLDLISDLELPPEFPKQKSYFIISAEGPNRVRANASLTLFGSGFDSDEEV
PSSFPLNTNRPAYSLPDSDGYHSHGTQTPTSDAFSEGQAQRDRGMDRYLDSLFDPVLSDS
SQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXPQQQYLLRLPARPPAARSAPPASARAPSPRVGGGAGGAGSAPMQGL
PGMPPLPVMPSYVAGPTTAPPPEAVVKASVNNTERLDPSHDIKDIVKQHQPPATPAPTQT
PGSQRKGDGKAFEKKSDPHDEAMEILKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXSRKLPMEEEIIQTQLHSRSSEEHYTYTNVPWKLYLRKEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKNVDQAVGTQDEEVKKKAITMAKDSW
DIYFSRLFPASGSVGTGVQVLSVSHRGIKLLKMVRSGSDGPDYFRILRPYSYSDILFVSI
PSKNMLEINLTNEKLILFSARAPQIKHMTDYFLTELKKDSEYVVGVRNFITEDRSLLSFH
KGDIIRLQHMDGLGPGKCYGCIVRKKVLLLEELKRDTPEFAGWRFGAVYGRSGVLPREFV
RPVAAPDFLVLPPERAEPRDRQGRVAASAAIAVAMGSAVAGHELDRSTEMVSETYGDAVN
EDLDEMAVQSGQYYLSEFARKYFREAQKNRRDQKNKKGKEGRDPVDMVKFNKSPLQESLI
DFSDRGLNRVATDIFIAIMRFMGDHPIKALTEQELVATILKLSGDHGLMKDEAYCQLMKQ
VXXXXXXXXDSCQRGWRLMYILTAFHRCSDVLKPYLLKFLQDACTGPGVQFQGIASACEQ
NLRRTFQYGGRIEFPNSMELKAMLAGRSSKRQLFLLPGGIERHLKVKTCSVALDAIEELC
FEMSLHRPEAIEEYAIFVVTHRGQNVRPLHKREYILDIATEAEPVDANYSLWFRRVIWGM
ALKLDNELYVTMHYNQVLPDFLKTLMSVVPQGQASDQQLQQVSRLAALQHRAKDTVYLPT
LREVQECVPSLFYSKQGSQHWLNMITQHMQQVQPLTPHQARAQFLGLVSAFPMFGSAFFY
IQSSSSASFQAPCILAVNQDGLHFLNKDTHEAMVRFPLKEVQSTRTQRPTAGSSYPYVDI
MIGDLLSQRITQLQLEGLELCRVIAMHMENMLSLREKRLTLPPSEITML
Download sequence
Identical sequences ENSGMOP00000011422 ENSGMOP00000011422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]