SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011504 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011504
Domain Number 1 Region: 539-737
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.2e-68
Family Hect, E3 ligase catalytic domain 0.00000162
Further Details:      
 
Domain Number 2 Region: 2-126
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.26e-20
Family PLC-like (P variant) 0.036
Further Details:      
 
Domain Number 3 Region: 281-321
Classification Level Classification E-value
Superfamily WW domain 0.000000000000348
Family WW domain 0.00072
Further Details:      
 
Domain Number 4 Region: 142-181
Classification Level Classification E-value
Superfamily WW domain 0.0000000000131
Family WW domain 0.001
Further Details:      
 
Domain Number 5 Region: 377-434
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.000000000209
Family Hect, E3 ligase catalytic domain 0.00069
Further Details:      
 
Domain Number 6 Region: 240-276
Classification Level Classification E-value
Superfamily WW domain 0.000000000709
Family WW domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011504   Gene: ENSGMOG00000010749   Transcript: ENSGMOT00000011816
Sequence length 744
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1449:199982:227197:1 gene:ENSGMOG00000010749 transcript:ENSGMOT00000011816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLSLSVLCAKNLVKKDFFRLPDPFSKVVVDGSGQCHSTDTVRNTLDPKWNQHYDLYIGK
ADSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLNKLSPSDSDTVRGQ
IVVSLQSRDRIGSGGPVVDCSQLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRP
ASEYSSPGRPLSCIVDENTPISANGATPTAVAPPTEQRAQERRVRSQRHRNYMSRTHLHA
PPLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNVNCEELGPLPPGWEIRNTAT
GRVYFVDHNNRTTQFTDPRLSANLHLVLXXXXXXXXXXAAVPQPAPAPSLLPLEEAECLT
VPRYKRDLVHKLKILRQELGHQQPQGGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMV
KFRGEEGLDYGGVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNDITGV
LDHTFCVEHSAYGEIIQHELKPNGKNVAVSQDTKKEYVRLYVNWRFLRGIEAQFLALQKG
FNEVIPQHLLKAFDEKELELIVCGLGKIDIVDWRSNTRLKHCTPDSNVVKWFWKAVESYD
EERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTLHQIDASSNNLPKAHTCFNRIDIPA
YEMYEKLYDKLLTAIEETCGFAVE
Download sequence
Identical sequences ENSGMOP00000011504 ENSGMOP00000011504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]