SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011506 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011506
Domain Number 1 Region: 619-793
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.0000922
Further Details:      
 
Domain Number 2 Region: 61-260
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-40
Family DBL homology domain (DH-domain) 0.00089
Further Details:      
 
Domain Number 3 Region: 275-343,401-435
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 479-594
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000144
Family Synaptotagmin-like (S variant) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011506   Gene: ENSGMOG00000010744   Transcript: ENSGMOT00000011818
Sequence length 838
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4342:181689:272127:-1 gene:ENSGMOG00000010744 transcript:ENSGMOT00000011818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNYTTDGYEGDGPEDVKSQDGSETMPFIDESPTMSPQLCTPHGDAASPSPPEGLLPGGDT
EKGLEMKKLVLSGFLASEEIYINQLEALLLPMRPLKAAATSSQPVLTIQQVETIFYKIQD
IFVIHKEFYDALYPHIQQWDEKVTVGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQAN
SQFQKISENLKVKGPKDSKDCTTTNTMEALLYKPIDRVTRSTLVLHDLLKHTPKDHPDFP
LLQDALRISQNFLSSINEEIDPRRTAVTTPKGEARQLVKDGFLVELSDCSRKLRHVFLFT
DLLLCAKMKKTSVGRQQQYECKWYIPLADLAFQTLDDSEPSPHVQVLPEHEIEEIKIKIS
VLKSEIQKEKKAPKGQSRVDRLRKKMNEQESWLLLHSPTIPFRIHNKHGKSFLFLISSDY
ERAEWRESIQRLQKNADIQSCVLSSVELQVLTSSCFKLRTVHNIPVTSYKDDEETPGLNG
FLHVIVRSAQGFKESANLYCTLEVDSYGYFVSKAKTRVFRDTTEPTWNEEFEIELEGSQC
LRILCYETCYDKSKISKDDNEIVDKIMGKGQVQLDPTTVQSKNWHMDVIEMNGIKVEFSM
KFTSRDLSLKRTPSKKQSGVFGVKINVVTKRERSKVPYIVRQCIEEVEKRGIDEVGIYRI
SGVATDIQTLKAAFDTNTKDILVMLSDMDINAIAGTLKLYFRELPEPLLTXXXXXXXXXX
XXLSDPAAKENCMMHLLRSLPDPNLITFLILLEHLKSRVAEKEPINKMSLHNLATVFGPT
LLRPSESEIAKTLSITTASDIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV
Download sequence
Identical sequences ENSGMOP00000011506 ENSGMOP00000011506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]