SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011530 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011530
Domain Number 1 Region: 289-605
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 6.54e-129
Family Mammalian PLC 0.0000000064
Further Details:      
 
Domain Number 2 Region: 132-284
Classification Level Classification E-value
Superfamily EF-hand 7.25e-42
Family EF-hand modules in multidomain proteins 0.0000936
Further Details:      
 
Domain Number 3 Region: 616-742
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.38e-30
Family PLC-like (P variant) 0.00018
Further Details:      
 
Domain Number 4 Region: 6-115
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-24
Family Pleckstrin-homology domain (PH domain) 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011530   Gene: ENSGMOG00000010770   Transcript: ENSGMOT00000011844
Sequence length 745
Comment pep:novel genescaffold:gadMor1:GeneScaffold_827:101167:116602:-1 gene:ENSGMOG00000010770 transcript:ENSGMOT00000011844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEGDGDLKFLLTGGTLVKVRSTSWQKSRYYKLQEDCKTMWHESRRTFKPKQTFSVEDIES
LRHGRLSEGLQKYTHPSAEDRCFSILFKDHHKHLDLMAASAEDARRWVSGLEKLVSNMRS
LSRQTKSFNLKKSWIFNCMRKADKNEDNKMTLKELKHFLRQINVEVDDTYAEELFKKCDK
SKSGSLEGPEIKHYYDLLTHREEIDVMFKKYANSEGHMSARDLLTFLLTEQREQVGLGHA
VTLINKYEMDETAKQTQHMTKDGFLMYMHHEDGAVLNPAHSAVHQDMGQPLNHYYISSSH
NTYLTADQLKGPSSTEAYIRALMKGCRCVELDCWDGSSGEPVIYHGYTLTSKVLFRDVIK
AIKDYAFKTSEYPVILSLENHCSVEQQQVMAQHMSSILGPALLTQPLGDTMPTCFPSPEE
LKGKFLIKGKRLNKLNAVFSNNNSAEVDSVSEEDEAGDSKENGDKAKPKKAKIQLAKELS
DMVLYCRSVHFGGFEHAKDSQAFYEMSSLKESKAFSLADTSGPAFLHHNMDKLTRIYPAG
SRTDSSNYNPVPMWNTGCQIVALNFQTTGKEMDLNQGRFLANGGCGYALKPEFQRDPSSQ
MNPSSLSKGPWLQKKMFHVMVISAQQLPKVNKEKHKSIVDPLVRVEVCGVDADNASKETN
HIENNGFNPMWNESFRFLVHVPELAMVRFLVEDYDSTSQNDLVGQYCLPLTSVQNGYRHV
PLLTKRGDVISSAGLFVHLMLLDTK
Download sequence
Identical sequences ENSGMOP00000011530 ENSGMOP00000011530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]