SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011606 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011606
Domain Number 1 Region: 21-124
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000146
Family V set domains (antibody variable domain-like) 0.007
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000011606
Domain Number - Region: 151-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00488
Family I set domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011606   Gene: ENSGMOG00000010863   Transcript: ENSGMOT00000011922
Sequence length 215
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1176:68380:69255:-1 gene:ENSGMOG00000010863 transcript:ENSGMOT00000011922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISVSCLFSLRCVSFFTALQVNGGWRVTYSSSNVCSLRGEMVYLSCTYEYPNNVQYRPATF
NTLWFTKVSNKQPVDLEHDADYTGRVESSCGLVKCPGSRCHGTCKLRIRDLRQTDSAFYK
FRFNTNQPGGENTGDPGVNNNTQDLQVKVSFPHPTDPTHAELECRSRCGLADDPPYIWFR
NGQNVGKGVNYRADIQSADSFSCAVDGHNLRSPLV
Download sequence
Identical sequences ENSGMOP00000011606 ENSGMOP00000011606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]