SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011619 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011619
Domain Number 1 Region: 2708-2976
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-69
Family Protein kinases, catalytic subunit 0.00000472
Further Details:      
 
Domain Number 2 Region: 1229-1407
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.1e-50
Family DBL homology domain (DH-domain) 0.0000000121
Further Details:      
 
Domain Number 3 Region: 1891-2082
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-42
Family DBL homology domain (DH-domain) 0.0000157
Further Details:      
 
Domain Number 4 Region: 1414-1533
Classification Level Classification E-value
Superfamily PH domain-like 1.89e-33
Family Pleckstrin-homology domain (PH domain) 0.000000868
Further Details:      
 
Domain Number 5 Region: 2090-2213
Classification Level Classification E-value
Superfamily PH domain-like 1.38e-28
Family Pleckstrin-homology domain (PH domain) 0.00082
Further Details:      
 
Domain Number 6 Region: 2602-2697
Classification Level Classification E-value
Superfamily Immunoglobulin 2.69e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 7 Region: 461-608
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-18
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 8 Region: 1049-1180
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-18
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 9 Region: 291-383
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000768
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 10 Region: 1590-1656
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000612
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 11 Region: 2467-2532
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000015
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 12 Region: 613-720
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000018
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 13 Region: 19-153
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000051
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 14 Region: 164-265
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000118
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 15 Region: 903-977
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000222
Family Spectrin repeat 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000011619
Domain Number - Region: 387-501
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00252
Family Spectrin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011619   Gene: ENSGMOG00000010825   Transcript: ENSGMOT00000011935
Sequence length 3008
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1603:7955:70277:1 gene:ENSGMOG00000010825 transcript:ENSGMOT00000011935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAIEVLPILKEKVAFLSAGGRDRRGGPVLTFPSRSNHDRIRQEDLRKLIAYLAGIPSED
VARHGFTVIVDMRGSKWDSIKPVLKILQESFPSCIHVALIIKPDNFWQKHRTNFGSSKFE
FETTMVSLEGLSKVVDPSQLTADFDGSLDYNHEEWIEVRVAFEEFSGHAGQMLSRLEEMQ
ETVARKDFPQDLEGARRMIEEHAALKKKVIKAPIEELDTEGQRLLQRIHSTEAFSNRSNV
DMGLVPRVNQLLDKLHTTRQQLHQAWHXXXXXXXXXXXXXXXXXXXXXMFDWILHNKGLF
LAGYTEIGNSHPHAAELQTQHNHFAMNCMNVYVNINRIMSVGNRLLESGHYASQQIKQIS
AQLEQEWKAFAAALDERSTLLEMSASFHQKCDQYMGNVESWCKACGEVELPSELQDLEDA
IHHHQGLYEHITATYSEVSQDGKALLDKLQRPLTPGSADSLTASANYSKAVHRVLDIIHQ
VLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRA
RALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRV
EQRKVLLDMSVAFHTHVKELWTWLEELQKELLDDVYAESVEAVQDLIKRFGQQQQTTLQV
TVNVIKEGEDLIQQLRDSAISSNKTPHNSSMAHIEGVLQQLDEAQAQMEELFQERKIKLE
LFLQLRIFERDAIDIISDLEAWNEELTSQMSEFDTEDLSLAEQQLQHHADKALTVNNLTF
DVIHQGQELLQYVNEVQASXXXXXXXXXVDMATRVQHLLEFLHEKQQEVDLAAEQRRRHL
EQCVQLRHLQAEVKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTHQS
ALQVQQKAEALLQANHYDMDLIRDCAESVASHWQQLMLKMEDRLKLVNASVAFYKTSEQV
CSVLESLEQEYKREEDWCGGADKLGPNCESEHVTPMISKHLEQKEAFLKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXILNELLQRENRVLHFWTLKKRRLDQCQQYLVF
LHSAKQALEWIHDTGEFYLSTHTSTGSSIHHTQELLKEHEDFHITAKQTKERVKLLIQLA
DGFCDKGHAHAVEIKKWVTAVDKRYRDFSLRMDKYRGSLEKALGISSDSNKQSKDLQLDI
IPASAPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMT
SGVEEIPPGIINKEHIIFGNMQDLYEFHHNIFLKELEKYEQLPEDVGHCFVTWADKFQMY
VNYCKNKPDSTQLILEFAGPYFDEIQQRHRLANSISSYLIKPVQRITKYQLLLKELLTCC
EEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENLESQGELILQDSFQVWDPKTLIRK
GRERHLFLFEMSLIFSKEVKDSNGRSKYIYKSKLFTSELGVTEHVEGDPCKFALWVGRTP
TSDNKIVLKASNIENKQDWIKHIREVIQERTIHLRGALKEPIHIPKATTAKHHKGDGEDL
DSQGEGSSQPDTISLASRTSQNTLDSDKLSGGCELTVVIHDFLAGNSNELTVRRGQTVEV
LERCHERPDWCLVRTTDRSPAHEGLVPCAVLCIAHSRSSMEMEGIFNHKDTLSVCSNDSI
LPGSSATLQPGHGMHIHTSPGPKPGNTLRKWLTSPVRRLSSGKADGHVKKLAHKHKKNRE
VRKSGDVGTLGSQKDSDDSAATPQDETVEERVRNEGLSSGTLSKSSSSGMQSCGEEEGEE
GADSVPLPPPMAIQQHSLLQPDAPDDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA
LEERPSSLSVDPGDSSSPSLNPSDNSLLSSSSPVDEVDERKTGSLRKRRYILVDLVESER
EYINDLSLLVDGYVSQMREEGIPEDMKGKDKIVFGNVVQIYDAQSSCELEKCLQDPDRLG
PLFVKQERRLNMYVVYCQNKPKSEQIVLEYIDTYFEELKQRLGHRLPISDLLSKPVLRIM
KYQLLLKDFLKSSRKAGMEFGDLEKAVEVMCLVPKRCNDVMSVGRLQGFDGKVVAQGRLL
LQDTFMVLEAQGGALGRMEERRVFLFEQLVLFSEPLDKKRGFSLPGFLYKSSIKVSCLGL
EENEEGDPCRFTLTSRGPSGATEALELHSSHPGVCQVWVLQIGQMLEGQQNLLNXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPQGKRPLQPPDDPAQT
PAPSNAVAPSPRATVGPTPSTPTSKPRPGTISPMASPMATPAFGKDALPLPPPSPGPKGG
SGFWSSMPGSPASRPGSFTFPGEVGESPSQGSHRHSTHSKEADRMSTCSSTSEQSIQSTQ
SNGSESSSSSSVSTMLVTQDYMAVKEDEVSVVQGEGVQILASNQQNMFLVFRAATEQGPA
AEGWIPGYVLGHTSALITDGPDGTVKKCSSWHTTLRIRKKSEKKEREGKKEIKLENGYRK
SKDGLANKVSVKLLNPNYIYDVPPEFLVPLADVTCDSGESVTLRCKVCGRPRASVTWKGP
HQSLLTNNGRCSIAYSDTGEATLRITGAAAEDDGSYTCEATNDLGTVTTTASLRVLAVSS
DGVRVSWKDSFESFYTEVAELGRGRFSVVKHCDHRGAKRSVAVKLVNKKLMRRDQVTQEL
SLLQRLQHPHLVGLLDTYETPSSYALVLEMADQGRLLDYIVSWGNLTEDKVACYLRDVLE
ALHYLHNSRVVHLDVKPENLLVSQSSGGPPSIKLTDFGDAVQLGGSHHVHALLGSPEFAP
EVVLGEPASPACDLWSLGVVTYVLLSGASPFLDESTEETCLNICRLDFSFPGDYFQGVGH
AARDFVCLLLRTDPGRRPPARLCLQEPWLQGGGAEVCLDTSRLISFIDRRRHQTDARPIG
GMRSFLHS
Download sequence
Identical sequences ENSGMOP00000011619 ENSGMOP00000011619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]