SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011626 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011626
Domain Number 1 Region: 644-853
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.16e-51
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 1281-1494,1577-1590
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000029
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 
Domain Number 3 Region: 847-953,1018-1050
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000103
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011626   Gene: ENSGMOG00000010857   Transcript: ENSGMOT00000011942
Sequence length 1618
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1628:53794:114682:1 gene:ENSGMOG00000010857 transcript:ENSGMOT00000011942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKTKHRISMSNPDIASDTMTLLSFLKTDLSDLRVRKVGGEKPSGAEERSTLYRRGSHSHG
NQSGCRPTLKDLTATLRRAKSFSYSDKSTLGVPCFSTSGTSKRSSSEQRLDVEDEGRRSI
SDREDRYIQEARQVMRDICQMSAREDDDDDMKSMQKGDSEESMFHHRSVDELSGHESSLT
DEGIVTEPETGLGEISESCFAGPAGVNLGNSKPFEAINTSNTEARPAGKWEGGLDAPATP
GAVRRRRKFSPTGNNNSDCSNGSSGESTSVSSGNGEATVYRSLSDPTPQRRCFVAGEGNS
NFCSMDSNLLGSLSVKGIGSVTESCPAAVLSESKGSVASDLSVCSDSALCDDSVRDYSGV
IRSIVAEPGAMDRLMVDDHGNGKAPKKKSFSDPSRRSDAQLLSPNDPHYKGHSNKNEPIS
ELEQAGQIPPSSSEPILSGQREKLWNPESENHGDEDVNGIDEGVGGRVDEGKKFNFDLKP
AEALSPRLGHQTSRKHTAEPDVESQEDLEGQDDLTPPLSRPETRTRHVRHASEPATFMPI
SPPAHSKLLKEANRSKIPPTAEPSLPSKPSGDEAPSLEDVTKRYILALSSTEKEAECPGP
LSGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMRRHVIMTLLDTEQ
SYVDALRTLIQGYMRPLKQPDSSCIVDPLLVDEMFYQIPEILEHHETFLEQVTSCVSQWH
DRQTVGHLLIQSFSKETLANIYSAYIDNFLNAKDAVRIAKEAKPAFLKFLEQSMRENREK
QALGDLMIKPVQRIPRYELLVKDLLKHTPEEHPDHPYLLDAQRGIKRLAEKINKGRRSAE
EAERETRVMQEIEAHIEGVEHIMNPQRKFLRQEMVMEGKTVGGRKDRSLFLFTDLLICTT
LKRKSGSLRRSSMSLYSAASLIDTSSKYKFLWKLSLEDIEMVKNSSQATNKENIQKMIGR
LDEDLNTLGQISKLSETLSFPHQSLDEVIKDLMASVHRELSDKQSLAFSMTFLPTKLEFA
TASAESSFLFEFSSPDARSNFEQAFEDAKKKLAMNKDQWDPEFLKAIPIMKTRSGMQFSC
ASPSHSCPDSGCEVWVCNSDGYVGQVCLLNIKDEPTVEACIAVCSARIICIAAVPGLKGR
SARTDRGVEPAHAPPPASSCPAHPQPQLHISISHSSLELSNQPAAGAEIVPFDSDDTDDE
DSPSPSSTLQSQASRSTISSSYGNEEGQGLKDMATETTSSEEEQEFPAPNPYGTESPMDG
RAMRRSSRGSFTRASLEDLLSIDPEAYQSSVWLGTEDGCIHVYQSSDNIRNRKNSMKIQH
SASILCILYLDNKVFVSLANGDVIVYQREAGSFWDAQSSQTLGLGTASSPITKMVPVGGK
LWCGSQNRVLVINTSTLVQEHWFQVGTDSSRCVTCMVAYGQGVWLALQGSALVRLYHAQT
WESLTEVDVAPAVHKMLAGADAIIRQHKAACLRITALLACKDLLWIGTSAGVVLTLAIPV
VSSGTGAATLKSPLVPMGSAHGHTGHVRFLTSIEFPEGFDVNFPKTSNEFAGNQSQGSSA
DNGGHGSLQRRDSTHHVIPKTNHLVISGGDGYEDFRLTNSSETVGRDDSTNHLLLWRV
Download sequence
Identical sequences ENSGMOP00000011626 ENSGMOP00000011626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]