SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011635 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011635
Domain Number 1 Region: 67-571
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.18e-189
Family Myeloperoxidase-like 0.000000000000317
Further Details:      
 
Domain Number 2 Region: 28-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000118
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011635   Gene: ENSGMOG00000010880   Transcript: ENSGMOT00000011951
Sequence length 614
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1134:158050:162121:1 gene:ENSGMOG00000010880 transcript:ENSGMOT00000011951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKVWSMNRSILAVLVLALGFLFCEGGTPCCSDPCQNRGVCTAMGAERYECDCTRTGFNGE
NCTNPEFFTWIKISLKPSPNTVHYLLTHFKGFWNIVNNMSVLRDAIMRYVLTSRSHLIAS
PPTYNSDYGYKNWEAFSNLSYYTRTLPPVANDCPTPMGVLGKKELPDIKMLAEKLLVRKH
FIPDPQGSSLMFAFFAQHFTHQFFKSDMKKGPAFTKAQGHGVDLNHVYGDNLERQHKLRL
HKDGKLKYQDIDGDMYPPTVASVGAEMHYPPHVPEEQRLAVGHEAFGLVPGLIMYATLWL
REHNRVCDVLRGVHPDWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYNFKLKFDPELL
FNQRFQYQNRISSEFNTLYHWHPLMPEAFHIEEQVYSYKQFVFNTSVVTNHGIGNLVDSF
TKQVSGRVAGGRNVPGALLHVAMKSIENARKMRYKSLNAYRKRFSMKPYSSFQDLTGETE
MAAVLEEMYGHVDAVELYPGLLVEKPRPNAIFGETMVEMGAPYSLKGLLGNPICSPEYWK
PSTFGGTAGFEIVNSASLQRLVCNNVRGPCPLASFRIPDLEQTGSVVINSSRPQHARTGE
VNPTVMLKERTTEL
Download sequence
Identical sequences ENSGMOP00000011635 ENSGMOP00000011635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]