SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011666 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011666
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily EF-hand 2.42e-18
Family S100 proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011666   Gene: ENSGMOG00000010916   Transcript: ENSGMOT00000011982
Sequence length 89
Comment pep:novel genescaffold:gadMor1:GeneScaffold_960:131096:132198:-1 gene:ENSGMOG00000010916 transcript:ENSGMOT00000011982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVAMEAAINVLVSQFKTHAGKDGAATTLSKEEFHSLVKSDLPNLVKNSADPAVIDRLMSS
LDENNDGELTFNEFWQLIGTLAGKQAGLT
Download sequence
Identical sequences ENSGMOP00000011666 ENSGMOP00000011666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]