SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011749 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011749
Domain Number 1 Region: 512-665
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-32
Family DBL homology domain (DH-domain) 0.00000324
Further Details:      
 
Domain Number 2 Region: 708-829
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-30
Family Pleckstrin-homology domain (PH domain) 0.0000138
Further Details:      
 
Domain Number 3 Region: 185-322
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000125
Family Spectrin repeat 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000011749
Domain Number - Region: 282-418
Classification Level Classification E-value
Superfamily Spectrin repeat 0.032
Family Spectrin repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011749   Gene: ENSGMOG00000010978   Transcript: ENSGMOT00000012066
Sequence length 831
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4322:340757:361731:1 gene:ENSGMOG00000010978 transcript:ENSGMOT00000012066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEANPLRGFPRLRRAATSFPGNLHLILVLRPSDLISPAPSPSSSTDLGFRFSQDDFLLK
MPVVMLRSVGDLLRYIDEHHLTTEFTAKVEYCQSDWVVLRRVTVKEVAQLLQGFGSELPR
RNSPTRPGPRVPADLAHAQIPPAQGYDMFQDDIRSVLKEGRLLQANLESATASEKEGVEE
KDIQADSDTVHRLLAQLRDMEEAFDGFFEKHHMKLQQYHQLLSYETSFQQMEEALENVSA
QEKGISSSGSTVVQTQQLLKDLEALDTHAQEEMNRAQLMILQGHQLAASHHYAQALIVQR
CNELRHLCDLVSAALRSKRALLTRARDLLLRLEEALRWCDEGAYLLASQMVDKFQTREGA
QEALQYLTIHQERAPSALKNSQDTLSLELEAILTPQLQAQIAMVTGKLSSVQCMIRNREH
CLRRLAELQVRPIQPVAPRPEQDQLSQRCKSPLFSPKHAGVDLNVLNSKFSFDLLPGKRT
PRRNSIQRKIEVMHDYQGNRSCLYGTLPDTDSEAESLFRHIMKELIATERVYVEELLSVL
LGYRAEMEDPAMLPLLPAALRNHKDLLFGNMPQIYQFHSXXXXXXXXXXXXXXXXXXXXX
XXXKMKFQVYERYCQNKPHSELLWRQSSDCPFFQECQKKLDHKLGLDSYLLKPIQRLTKY
QLLLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDLSQLGRVVLQG
GFSVWISHKRAAVRMKELPRFKPMQRHLFLYEHALLFCKRRDDDGPDRTPFYSFKHMSAV
GITENVKGDVKKFEVWYSGREEVYILQASTLEVKVSWLTAIRKILTNQQKL
Download sequence
Identical sequences ENSGMOP00000011749 ENSGMOP00000011749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]