SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011832 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011832
Domain Number 1 Region: 91-296
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.51e-53
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 316-436
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000438
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011832   Gene: ENSGMOG00000011058   Transcript: ENSGMOT00000012150
Sequence length 476
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2185:429761:434342:1 gene:ENSGMOG00000011058 transcript:ENSGMOT00000012150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEEDEEDDHEKTTEHKKDPEEPSTKRVRPVAKSNSLTGVITPAKTPALKRFGQSITRSIS
FRTEARPLPPANMRSRQKPPLFTRKHNSQCWSDTVESHDLTAKEIKRQEVIYELTQGEKQ
LIEDLILVKKVYYEPMLKLEIMTESELGHIFGTLDSLIPLHEDFLTRLEKLRGSEKTVGE
VAPTLMNWFPCLEAYITYCCNQVGAKALLDLKKQDKAVERFLLLCQESPFSRKLDLWNFL
DLPRSRLVKYPLLLKEIQKCTPPEHPDEDILPDALELILSIVEEVNKKTGEAECQFYRRG
LAYMEESQRIPEIQLSRFLYCQGELKNSKGQRLHVFLFELALVLTRLGEDREGGHLYQVY
RQPFPNALLNLEDIPDSEAGGGGTFRTAFTGGNDKVRNCFRVSSRGRAKAQSHSLQANDS
FNKQQWITCLRQAIQSRDRSSLTSQNLQSPPPDPTLNNLADLSLNPAIEMTHHATH
Download sequence
Identical sequences ENSGMOP00000011832 ENSGMOP00000011832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]