SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011835 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011835
Domain Number 1 Region: 36-623
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2.12e-188
Family Myeloperoxidase-like 0.0000000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011835   Gene: ENSGMOG00000011009   Transcript: ENSGMOT00000012153
Sequence length 628
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3734:37277:41834:-1 gene:ENSGMOG00000011009 transcript:ENSGMOT00000012153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPDLLPREDLEVLSKISGCAAMVSDPPCRTIQNLDKYRTATSVCNNLMSPRLGASNTPFK
RWLPAQYDDGVALPNGWERNRRFNNFVLPLVREVSNRILATPDEGVVNDPEFSHMTTLFG
QWNDHDLTFTPFSPSIRSFSNGLNCDESCERSEPCFPIQIPRGDPRLPTGPDSCIPVFRS
AAVCGTGNSAFNFGGVANKREQINTLTAFLDLGQVYGSEEQLAMDLRNLTTDAGLLRVND
KFRDNGRELLPFSPLLPKMCATRQRVTNNSKAEEVPCFLAGCDVRVDENIALTSLHTLFM
REHNRLARELKKLNPQWDGETLYQEARKIMGAYTQVLVFRDYLPHIVGDVAMSRLLGPYP
GYNPNVDPSIANVFATAAYRFAHLAIQPFLARLDQNYRENARIPNVPLFKAFFTPWRIVF
EGGIDPLIRGLAGRPAKLNAKKPVLVNALRERLFQFVMHLALDLGSLNMQRGRDHAIPGY
NAWRKFCGLSQPGNQAELARVLNNAGLATRLLQLYGTPSNIDVWLGGVAEPLVQGGRVGP
LFACLIAKQFKNIRQGDRLWYENQGVFSPSQRNVLRTASLARIICDNTGISSVPLDPFSL
LSRRNRLVSCSRIRSISLLPWRERPHDE
Download sequence
Identical sequences ENSGMOP00000011835 ENSGMOP00000011835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]