SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011850 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011850
Domain Number 1 Region: 543-631
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-19
Family Third domain of FERM 0.0058
Further Details:      
 
Domain Number 2 Region: 356-448
Classification Level Classification E-value
Superfamily PH domain-like 4.48e-17
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 3 Region: 253-298
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000598
Family Second domain of FERM 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000011850
Domain Number - Region: 490-542
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000183
Family Second domain of FERM 0.0069
Further Details:      
 
Domain Number - Region: 28-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0468
Family Ubiquitin-related 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011850   Gene: ENSGMOG00000011072   Transcript: ENSGMOT00000012168
Sequence length 654
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2414:75436:91966:-1 gene:ENSGMOG00000011072 transcript:ENSGMOT00000012168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTAAEYGNTSWELAVKVDQKEGEESMRFKLRIKGDLHVGGLMLKLVEKIKTQQDWSDHA
LWWGQRNMWVLKTHWTLDKYGIQSDADLCYTPQHKPLLLQLPNMKTVKMTVSYSNVVFKA
VAEICRVLNIRRPEEVSLLKHTEDCKKKKKKEKNAFLDEVLDMDPAHSKTMVATYDPENG
MPLTATSLWFGDNPFTASQPNLPPADLAKMYQALSLEDKTTINAGWLDSSRSLMEQGIQE
DDKLLLRFKYHVFFDLNPKYDAVRITQLYEQARWCILLEEIDCTDEEMLMFASLQYHICK
LTTSSEPLDFSNEPEIDEVEAALSNLEVTLEGGNTDRLLEDITDIPELADSLRLFRPRKL
SLRPYKEYWFVFKDTSISYYKNKESSMGEPIEQLHLRGCEVVPDVNVTDKKFGIKLLLPV
ADGMNEVYIRCDNEVQYSKWKAACVLASKGKTMAYSSYRSEVKKIQSFLQMKSLAPSPGQ
SASNVEAMDMVAECFVSPRYAKKHKSKQLTGRIQEAHQHVARLSLMEAKMRFIQAWQSLP
EFGIKYYIVRFRGSKKDEILGISYNRMIRIDMSSSLPVTTWRFANMKQWNVNWEIRQVAI
EFDQNVSIAFSCVSCDCKVVHEFIGGYIFLSTRSKDQNETLDEELFHKLTGGQE
Download sequence
Identical sequences ENSGMOP00000011850 ENSGMOP00000011850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]